Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LC16

Protein Details
Accession A0A3N4LC16   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
213-246ISPNERRKRYIEKMIRRHMQKQRRIKLTRRGEVVHydrophilic
NLS Segment(s)
PositionSequence
218-240RRKRYIEKMIRRHMQKQRRIKLT
Subcellular Location(s) cyto 18, nucl 6, mito 1, extr 1, pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR008685  Centromere_Mis12  
Gene Ontology GO:0000776  C:kinetochore  
GO:0005634  C:nucleus  
GO:0051301  P:cell division  
GO:0000278  P:mitotic cell cycle  
Pfam View protein in Pfam  
PF05859  Mis12  
Amino Acid Sequences MHQLETLLGALIDKNFDKFEIYVLRNVLTVPDGLVGWVRLPHHKGYDFKPRPIDAPPIPTATAPPATPAAVPAPNEGYAWYHPTHPTNDTFTRLREKLIASHYLNQTLKTEVSSNAALISKLKAALANTSPTDTAPSASLSFLTTSTPTTLHPLPTTAEFIALQISSIRSLLATLPPKLTTSFDSLTSPTSDDDENTPLAPDLSDLDPTNPSISPNERRKRYIEKMIRRHMQKQRRIKLTRRGEVVGGEYWDGVAASGGGVGLAGEKRRGLEEVAALERLFGIEGGGEEGKEKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.15
5 0.14
6 0.19
7 0.24
8 0.26
9 0.28
10 0.29
11 0.29
12 0.27
13 0.27
14 0.23
15 0.15
16 0.13
17 0.09
18 0.09
19 0.08
20 0.08
21 0.09
22 0.09
23 0.08
24 0.11
25 0.12
26 0.17
27 0.2
28 0.24
29 0.29
30 0.34
31 0.37
32 0.41
33 0.51
34 0.51
35 0.53
36 0.56
37 0.52
38 0.49
39 0.49
40 0.51
41 0.43
42 0.43
43 0.4
44 0.36
45 0.35
46 0.33
47 0.3
48 0.26
49 0.24
50 0.17
51 0.17
52 0.15
53 0.15
54 0.15
55 0.15
56 0.15
57 0.15
58 0.16
59 0.16
60 0.17
61 0.16
62 0.17
63 0.16
64 0.15
65 0.14
66 0.16
67 0.16
68 0.16
69 0.18
70 0.21
71 0.23
72 0.23
73 0.25
74 0.28
75 0.29
76 0.32
77 0.31
78 0.31
79 0.36
80 0.33
81 0.32
82 0.29
83 0.28
84 0.28
85 0.3
86 0.34
87 0.28
88 0.34
89 0.34
90 0.38
91 0.37
92 0.33
93 0.31
94 0.25
95 0.23
96 0.18
97 0.18
98 0.12
99 0.14
100 0.13
101 0.12
102 0.12
103 0.12
104 0.11
105 0.1
106 0.1
107 0.08
108 0.08
109 0.08
110 0.08
111 0.08
112 0.11
113 0.12
114 0.13
115 0.13
116 0.13
117 0.13
118 0.12
119 0.14
120 0.11
121 0.1
122 0.08
123 0.09
124 0.09
125 0.09
126 0.09
127 0.07
128 0.08
129 0.07
130 0.07
131 0.07
132 0.07
133 0.07
134 0.08
135 0.08
136 0.11
137 0.12
138 0.12
139 0.12
140 0.12
141 0.12
142 0.13
143 0.15
144 0.11
145 0.11
146 0.09
147 0.09
148 0.09
149 0.08
150 0.07
151 0.05
152 0.06
153 0.05
154 0.05
155 0.05
156 0.04
157 0.05
158 0.06
159 0.1
160 0.13
161 0.14
162 0.15
163 0.15
164 0.16
165 0.17
166 0.18
167 0.15
168 0.17
169 0.17
170 0.17
171 0.18
172 0.18
173 0.19
174 0.18
175 0.16
176 0.12
177 0.12
178 0.11
179 0.11
180 0.12
181 0.13
182 0.12
183 0.12
184 0.12
185 0.1
186 0.1
187 0.09
188 0.07
189 0.08
190 0.08
191 0.1
192 0.1
193 0.11
194 0.12
195 0.13
196 0.14
197 0.12
198 0.12
199 0.14
200 0.19
201 0.27
202 0.37
203 0.46
204 0.49
205 0.53
206 0.58
207 0.64
208 0.66
209 0.68
210 0.68
211 0.69
212 0.74
213 0.81
214 0.83
215 0.79
216 0.81
217 0.8
218 0.79
219 0.79
220 0.8
221 0.79
222 0.82
223 0.84
224 0.83
225 0.83
226 0.84
227 0.81
228 0.75
229 0.68
230 0.58
231 0.53
232 0.47
233 0.38
234 0.29
235 0.22
236 0.17
237 0.14
238 0.13
239 0.11
240 0.07
241 0.05
242 0.04
243 0.03
244 0.03
245 0.03
246 0.03
247 0.03
248 0.03
249 0.05
250 0.06
251 0.08
252 0.09
253 0.1
254 0.11
255 0.13
256 0.15
257 0.15
258 0.16
259 0.19
260 0.22
261 0.24
262 0.24
263 0.23
264 0.21
265 0.19
266 0.16
267 0.13
268 0.08
269 0.06
270 0.05
271 0.06
272 0.09
273 0.09
274 0.09