Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LL03

Protein Details
Accession A0A3N4LL03   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
103-123SDDSTDPKRRKRGGVRGEPGDBasic
NLS Segment(s)
PositionSequence
36-38KKK
110-115KRRKRG
Subcellular Location(s) nucl 15cyto_nucl 15, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR045379  Crinkler_N  
Gene Ontology GO:0005576  C:extracellular region  
Pfam View protein in Pfam  
PF20147  Crinkler  
Amino Acid Sequences MLELNCLVLGETEQNIFTVEIEATKKVSILKDLIKKKKKPVFDYIPADSLTLWKWNKSISKVTVEDLRSDNPLAPTKKISIVFREDSLEEEYIHIIIQAPIDSDDSTDPKRRKRGGVRGEPGDQGIVVGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.1
5 0.09
6 0.08
7 0.1
8 0.12
9 0.12
10 0.12
11 0.12
12 0.13
13 0.14
14 0.15
15 0.16
16 0.18
17 0.25
18 0.32
19 0.42
20 0.52
21 0.59
22 0.63
23 0.7
24 0.73
25 0.74
26 0.71
27 0.71
28 0.7
29 0.69
30 0.7
31 0.62
32 0.58
33 0.5
34 0.44
35 0.33
36 0.25
37 0.17
38 0.18
39 0.15
40 0.14
41 0.14
42 0.18
43 0.21
44 0.24
45 0.28
46 0.25
47 0.3
48 0.3
49 0.31
50 0.33
51 0.3
52 0.28
53 0.24
54 0.22
55 0.18
56 0.18
57 0.17
58 0.14
59 0.2
60 0.19
61 0.19
62 0.2
63 0.2
64 0.24
65 0.26
66 0.26
67 0.24
68 0.28
69 0.28
70 0.27
71 0.28
72 0.24
73 0.23
74 0.24
75 0.2
76 0.15
77 0.14
78 0.13
79 0.11
80 0.11
81 0.08
82 0.06
83 0.06
84 0.07
85 0.06
86 0.06
87 0.07
88 0.09
89 0.09
90 0.09
91 0.11
92 0.14
93 0.18
94 0.26
95 0.31
96 0.38
97 0.47
98 0.51
99 0.59
100 0.66
101 0.73
102 0.75
103 0.81
104 0.81
105 0.78
106 0.76
107 0.67
108 0.58
109 0.48
110 0.36