Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LRD6

Protein Details
Accession A0A3N4LRD6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
154-176EEEKEKEKEKEKEKEKEKKKEKABasic
NLS Segment(s)
PositionSequence
80-92KAKAKAKAKAKAA
157-176KEKEKEKEKEKEKEKKKEKA
Subcellular Location(s) mito 16.5, cyto_mito 12.666, cyto 7.5, cyto_nucl 6.333
Family & Domain DBs
Amino Acid Sequences MSASTQQNLFTPPPMPTIPLIPGPTPTNAFTLPAVSPTPSKPSTSARASKALLTFPAFTDGNPFSFVAEEEVVMEVARYKAKAKAKAKAKAAWVSKQGKLREEWVMDVFRRTGRVPMCSWPRAHGEDGKVAAGVVDGETVGMGVKEDGEDGEEEEEKEKEKEKEKEKEKEKKKEKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.2
4 0.22
5 0.23
6 0.25
7 0.26
8 0.22
9 0.25
10 0.25
11 0.26
12 0.26
13 0.24
14 0.23
15 0.2
16 0.21
17 0.18
18 0.18
19 0.16
20 0.16
21 0.15
22 0.14
23 0.15
24 0.16
25 0.22
26 0.21
27 0.22
28 0.23
29 0.28
30 0.33
31 0.39
32 0.43
33 0.4
34 0.44
35 0.43
36 0.43
37 0.4
38 0.34
39 0.28
40 0.24
41 0.22
42 0.17
43 0.2
44 0.17
45 0.15
46 0.18
47 0.17
48 0.16
49 0.16
50 0.16
51 0.12
52 0.12
53 0.12
54 0.1
55 0.09
56 0.08
57 0.07
58 0.07
59 0.07
60 0.06
61 0.06
62 0.04
63 0.05
64 0.06
65 0.06
66 0.07
67 0.13
68 0.19
69 0.28
70 0.31
71 0.38
72 0.46
73 0.53
74 0.55
75 0.53
76 0.52
77 0.5
78 0.49
79 0.45
80 0.44
81 0.42
82 0.42
83 0.44
84 0.42
85 0.37
86 0.35
87 0.34
88 0.31
89 0.27
90 0.25
91 0.21
92 0.22
93 0.2
94 0.2
95 0.18
96 0.15
97 0.16
98 0.15
99 0.17
100 0.17
101 0.2
102 0.21
103 0.28
104 0.34
105 0.35
106 0.35
107 0.34
108 0.36
109 0.36
110 0.37
111 0.33
112 0.29
113 0.29
114 0.3
115 0.27
116 0.22
117 0.18
118 0.15
119 0.11
120 0.09
121 0.05
122 0.04
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.04
133 0.04
134 0.04
135 0.06
136 0.06
137 0.07
138 0.09
139 0.1
140 0.11
141 0.12
142 0.13
143 0.14
144 0.15
145 0.2
146 0.24
147 0.32
148 0.41
149 0.49
150 0.59
151 0.66
152 0.75
153 0.79
154 0.84
155 0.86
156 0.88