Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LEP7

Protein Details
Accession A0A3N4LEP7    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
41-60YPEPHKSRNKNTQTIRHPTHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 7, nucl 6, cyto_mito 6
Family & Domain DBs
Amino Acid Sequences MFYVGILCYSSLFLRWYPMLLLIIQTLATPQQYPPTLDVLYPEPHKSRNKNTQTIRHPTHRNHTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.13
5 0.14
6 0.13
7 0.12
8 0.12
9 0.08
10 0.08
11 0.07
12 0.07
13 0.06
14 0.05
15 0.06
16 0.05
17 0.05
18 0.09
19 0.1
20 0.11
21 0.12
22 0.15
23 0.15
24 0.14
25 0.16
26 0.15
27 0.17
28 0.18
29 0.2
30 0.19
31 0.25
32 0.33
33 0.38
34 0.45
35 0.53
36 0.59
37 0.66
38 0.73
39 0.77
40 0.78
41 0.81
42 0.79
43 0.77
44 0.77
45 0.75