Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4M8X0

Protein Details
Accession A0A3N4M8X0    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
65-85SGKNRGRKKPMHTQKNTIEYLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13, nucl 12.5, mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024158  Mt_import_TIM15  
IPR007853  Znf_DNL-typ  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05180  zf-DNL  
PROSITE View protein in PROSITE  
PS51501  ZF_DNL  
Amino Acid Sequences PKKPTYELTFTCMPCGHRSSHTITEQAFLFGTVLVRCPSCYERHVISDHLKIFNEEPMSFEDILSGKNRGRKKPMHTQKNTIEYLDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.3
4 0.26
5 0.29
6 0.33
7 0.38
8 0.38
9 0.36
10 0.34
11 0.33
12 0.3
13 0.27
14 0.2
15 0.13
16 0.11
17 0.08
18 0.09
19 0.06
20 0.07
21 0.07
22 0.08
23 0.08
24 0.1
25 0.12
26 0.14
27 0.15
28 0.17
29 0.18
30 0.2
31 0.21
32 0.22
33 0.23
34 0.25
35 0.26
36 0.24
37 0.23
38 0.22
39 0.21
40 0.21
41 0.2
42 0.15
43 0.14
44 0.15
45 0.18
46 0.17
47 0.16
48 0.15
49 0.13
50 0.15
51 0.15
52 0.15
53 0.15
54 0.21
55 0.28
56 0.33
57 0.41
58 0.48
59 0.54
60 0.63
61 0.71
62 0.76
63 0.77
64 0.8
65 0.8
66 0.81
67 0.75