Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LWF7

Protein Details
Accession A0A3N4LWF7   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
81-116SKIVRVRSREGRRNRAPPPRIRFNKDGKKINPNQAPHydrophilic
NLS Segment(s)
PositionSequence
85-109RVRSREGRRNRAPPPRIRFNKDGKK
Subcellular Location(s) mito 11.5, mito_nucl 11, nucl 9.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRSANGRNKNGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFNEYVVPKMYLKLQYCVSCAIHSKIVRVRSREGRRNRAPPPRIRFNKDGKKINPNQAPAKTTTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.74
3 0.73
4 0.71
5 0.68
6 0.69
7 0.72
8 0.7
9 0.64
10 0.66
11 0.65
12 0.65
13 0.66
14 0.66
15 0.63
16 0.65
17 0.68
18 0.69
19 0.71
20 0.71
21 0.72
22 0.73
23 0.75
24 0.71
25 0.72
26 0.68
27 0.68
28 0.6
29 0.52
30 0.45
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.11
38 0.1
39 0.09
40 0.08
41 0.08
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.08
48 0.08
49 0.08
50 0.09
51 0.09
52 0.08
53 0.09
54 0.12
55 0.16
56 0.17
57 0.19
58 0.21
59 0.22
60 0.23
61 0.25
62 0.23
63 0.18
64 0.2
65 0.19
66 0.22
67 0.21
68 0.24
69 0.26
70 0.33
71 0.36
72 0.38
73 0.42
74 0.47
75 0.56
76 0.62
77 0.67
78 0.69
79 0.74
80 0.78
81 0.81
82 0.81
83 0.8
84 0.8
85 0.79
86 0.8
87 0.8
88 0.79
89 0.78
90 0.78
91 0.8
92 0.8
93 0.81
94 0.76
95 0.79
96 0.79
97 0.82
98 0.79
99 0.75
100 0.74
101 0.7
102 0.68