Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4L4N1

Protein Details
Accession A0A3N4L4N1   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-22EKLDLSKKEIRKDNQRKSGVYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000305  GIY-YIG_endonuc  
IPR035901  GIY-YIG_endonuc_sf  
Gene Ontology GO:0004519  F:endonuclease activity  
Pfam View protein in Pfam  
PF01541  GIY-YIG  
PROSITE View protein in PROSITE  
PS50164  GIY_YIG  
Amino Acid Sequences MEKLDLSKKEIRKDNQRKSGVYMWVNQKSGFRYVGSATDLLNRLSTFYLNENSLKNYKKGNFRICNALLKYKYSAFNLEILEYCE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.81
4 0.73
5 0.71
6 0.69
7 0.64
8 0.55
9 0.51
10 0.5
11 0.49
12 0.49
13 0.43
14 0.39
15 0.34
16 0.34
17 0.29
18 0.2
19 0.17
20 0.16
21 0.17
22 0.16
23 0.14
24 0.12
25 0.14
26 0.14
27 0.13
28 0.13
29 0.11
30 0.1
31 0.1
32 0.1
33 0.08
34 0.09
35 0.11
36 0.12
37 0.13
38 0.13
39 0.16
40 0.21
41 0.22
42 0.22
43 0.27
44 0.31
45 0.39
46 0.46
47 0.54
48 0.55
49 0.56
50 0.63
51 0.59
52 0.62
53 0.55
54 0.55
55 0.46
56 0.43
57 0.44
58 0.4
59 0.41
60 0.35
61 0.36
62 0.29
63 0.32
64 0.3
65 0.28