Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LXM8

Protein Details
Accession A0A3N4LXM8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
24-44ILPIRPGRRNLNKPRTYRRVFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, extr 10, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MARPLRLALYWSSVRCTILLVLGILPIRPGRRNLNKPRTYRRVFYFLTSNHGTYTSAMHGPYVHVLGSHRFSNRVERRSASVPKPGSWTQVTCTCKLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.23
4 0.17
5 0.14
6 0.13
7 0.1
8 0.09
9 0.1
10 0.1
11 0.08
12 0.08
13 0.09
14 0.11
15 0.13
16 0.17
17 0.25
18 0.35
19 0.45
20 0.56
21 0.64
22 0.7
23 0.75
24 0.82
25 0.82
26 0.76
27 0.71
28 0.64
29 0.6
30 0.53
31 0.48
32 0.44
33 0.35
34 0.36
35 0.32
36 0.28
37 0.22
38 0.21
39 0.19
40 0.14
41 0.15
42 0.11
43 0.1
44 0.1
45 0.1
46 0.09
47 0.09
48 0.1
49 0.09
50 0.07
51 0.06
52 0.08
53 0.1
54 0.13
55 0.16
56 0.15
57 0.17
58 0.19
59 0.29
60 0.36
61 0.38
62 0.39
63 0.38
64 0.43
65 0.49
66 0.55
67 0.48
68 0.49
69 0.48
70 0.46
71 0.5
72 0.46
73 0.44
74 0.41
75 0.39
76 0.35
77 0.41
78 0.42