Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LP96

Protein Details
Accession A0A3N4LP96    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MMPAAEKNASRKRRERREKEGGEAVHydrophilic
NLS Segment(s)
PositionSequence
9-21ASRKRRERREKEG
Subcellular Location(s) mito 9, nucl 4, cyto 4, cyto_nucl 4, golg 3, extr 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MMPAAEKNASRKRRERREKEGGEAVGSCSRGKRQNRRPVAVLPPSPNWLRSVIGANPTPVNATSITGALGIHAFILLLCLRGRYSLPTALLGFGRRTRSNFSSVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.84
4 0.88
5 0.84
6 0.82
7 0.78
8 0.67
9 0.57
10 0.48
11 0.41
12 0.32
13 0.28
14 0.22
15 0.16
16 0.2
17 0.26
18 0.35
19 0.43
20 0.51
21 0.61
22 0.69
23 0.72
24 0.71
25 0.68
26 0.67
27 0.63
28 0.56
29 0.49
30 0.42
31 0.4
32 0.37
33 0.32
34 0.26
35 0.2
36 0.17
37 0.14
38 0.16
39 0.14
40 0.16
41 0.16
42 0.16
43 0.14
44 0.14
45 0.13
46 0.1
47 0.11
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.07
54 0.07
55 0.06
56 0.05
57 0.05
58 0.04
59 0.03
60 0.03
61 0.03
62 0.04
63 0.04
64 0.06
65 0.06
66 0.07
67 0.07
68 0.09
69 0.1
70 0.12
71 0.16
72 0.18
73 0.19
74 0.21
75 0.22
76 0.22
77 0.23
78 0.22
79 0.22
80 0.22
81 0.28
82 0.28
83 0.31
84 0.37
85 0.39