Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LHZ9

Protein Details
Accession A0A3N4LHZ9   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-34IPTSMDPKSSRPQKKKRLMNPTSQQSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSEPIPESIPTSMDPKSSRPQKKKRLMNPTSQQSVQLNQLFKKPDRVINLSGPKAKTLPSPPEIVANVQGSSAGAGSGEFHVYKASRRRENERVKMMDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.34
4 0.43
5 0.52
6 0.59
7 0.69
8 0.75
9 0.84
10 0.89
11 0.89
12 0.9
13 0.84
14 0.84
15 0.83
16 0.8
17 0.75
18 0.64
19 0.58
20 0.48
21 0.44
22 0.4
23 0.34
24 0.29
25 0.25
26 0.28
27 0.29
28 0.28
29 0.34
30 0.3
31 0.31
32 0.33
33 0.36
34 0.36
35 0.39
36 0.44
37 0.38
38 0.4
39 0.36
40 0.31
41 0.28
42 0.25
43 0.21
44 0.21
45 0.24
46 0.23
47 0.25
48 0.25
49 0.27
50 0.27
51 0.24
52 0.23
53 0.18
54 0.16
55 0.13
56 0.13
57 0.1
58 0.09
59 0.08
60 0.05
61 0.03
62 0.03
63 0.05
64 0.05
65 0.07
66 0.07
67 0.07
68 0.1
69 0.11
70 0.18
71 0.25
72 0.34
73 0.41
74 0.47
75 0.56
76 0.64
77 0.74
78 0.78
79 0.79
80 0.74