Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LTH8

Protein Details
Accession A0A3N4LTH8   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
100-125VYRPRHQSPLLKKRKKVRWADGWVDSHydrophilic
NLS Segment(s)
PositionSequence
111-115KKRKK
Subcellular Location(s) extr 9, mito 6, cyto 5.5, cyto_nucl 5, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MLYFIAILLTILATLATAATSMARQTTVAHRIELDAKVQRSIDLQVLAEFKEERVLQYCTDQLKRLQVEKYCNDQWTSFLASRQIQEENAQAQAQLVSLVYRPRHQSPLLKKRKKVRWADGWVDSDAGSTTECDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.04
7 0.04
8 0.05
9 0.06
10 0.06
11 0.07
12 0.09
13 0.15
14 0.21
15 0.22
16 0.22
17 0.22
18 0.23
19 0.26
20 0.25
21 0.23
22 0.22
23 0.22
24 0.23
25 0.23
26 0.21
27 0.19
28 0.2
29 0.18
30 0.13
31 0.13
32 0.13
33 0.13
34 0.13
35 0.13
36 0.11
37 0.09
38 0.12
39 0.11
40 0.1
41 0.13
42 0.14
43 0.14
44 0.15
45 0.18
46 0.18
47 0.2
48 0.2
49 0.19
50 0.23
51 0.24
52 0.26
53 0.26
54 0.26
55 0.31
56 0.32
57 0.37
58 0.34
59 0.33
60 0.31
61 0.28
62 0.25
63 0.22
64 0.23
65 0.17
66 0.16
67 0.18
68 0.18
69 0.19
70 0.2
71 0.18
72 0.15
73 0.15
74 0.17
75 0.15
76 0.15
77 0.14
78 0.12
79 0.11
80 0.1
81 0.09
82 0.07
83 0.06
84 0.05
85 0.06
86 0.11
87 0.12
88 0.16
89 0.21
90 0.24
91 0.29
92 0.32
93 0.4
94 0.47
95 0.57
96 0.65
97 0.69
98 0.72
99 0.78
100 0.84
101 0.85
102 0.84
103 0.83
104 0.82
105 0.82
106 0.83
107 0.79
108 0.72
109 0.63
110 0.53
111 0.43
112 0.33
113 0.25
114 0.18
115 0.11