Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LX17

Protein Details
Accession A0A3N4LX17    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-36STSPSAPKAPRPNKPPKQAKPSKLQKDKDIHydrophilic
NLS Segment(s)
PositionSequence
13-29PKAPRPNKPPKQAKPSK
111-128LKPPAGAKEGSRKKPRTA
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
Amino Acid Sequences MPANGTSTSPSAPKAPRPNKPPKQAKPSKLQKDKDIQAHQSSTIAATNSTVKVSQNVGAKAKDKDASAGSKDGSGAVGGNGPGGKGKNKRTVDVLSLFSEKEMSAGGTIRLKPPAGAKEGSRKKPRTASQGNWKERAKELEEQGKFNEIYILNIPGRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.5
3 0.58
4 0.66
5 0.75
6 0.78
7 0.85
8 0.87
9 0.86
10 0.88
11 0.89
12 0.87
13 0.86
14 0.87
15 0.87
16 0.86
17 0.81
18 0.78
19 0.78
20 0.77
21 0.76
22 0.72
23 0.66
24 0.61
25 0.58
26 0.5
27 0.41
28 0.34
29 0.26
30 0.2
31 0.15
32 0.1
33 0.1
34 0.11
35 0.11
36 0.12
37 0.11
38 0.1
39 0.12
40 0.13
41 0.16
42 0.18
43 0.2
44 0.22
45 0.24
46 0.26
47 0.26
48 0.27
49 0.25
50 0.2
51 0.2
52 0.19
53 0.2
54 0.19
55 0.19
56 0.17
57 0.15
58 0.15
59 0.13
60 0.1
61 0.07
62 0.06
63 0.04
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.06
71 0.1
72 0.15
73 0.21
74 0.3
75 0.32
76 0.33
77 0.36
78 0.38
79 0.37
80 0.35
81 0.32
82 0.24
83 0.24
84 0.23
85 0.19
86 0.17
87 0.13
88 0.1
89 0.08
90 0.06
91 0.05
92 0.06
93 0.08
94 0.11
95 0.12
96 0.13
97 0.15
98 0.15
99 0.15
100 0.2
101 0.22
102 0.22
103 0.23
104 0.24
105 0.34
106 0.43
107 0.51
108 0.56
109 0.57
110 0.59
111 0.67
112 0.71
113 0.7
114 0.7
115 0.7
116 0.71
117 0.78
118 0.78
119 0.76
120 0.72
121 0.65
122 0.6
123 0.57
124 0.51
125 0.47
126 0.49
127 0.51
128 0.51
129 0.5
130 0.47
131 0.46
132 0.41
133 0.34
134 0.32
135 0.22
136 0.23
137 0.23
138 0.27