Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1WP14

Protein Details
Accession K1WP14    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
176-201GERAAVRKAEQKRKKRERVEAEQAEAHydrophilic
NLS Segment(s)
PositionSequence
173-212PGKGERAAVRKAEQKRKKRERVEAEQAEAKARKVEEKEMA
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 5, cyto 4.5
Family & Domain DBs
KEGG mbe:MBM_02662  -  
Amino Acid Sequences MEFPYGPGYDQYGRTIGLRRRSSTSHVALPAFHAPSAAISVPAARRLTLRGIPTPFTDAAEVSSPVSIPLLASSASNLTPQSYFLNTPFAPATFRAWILTSRSTAIAASYAPSTASLPATKAKRIIFELLDAATEENLDRIKDIETAVKLLNELDIWWTMKPTREEIEAARFPGKGERAAVRKAEQKRKKRERVEAEQAEAKARKVEEKEMARRQREVMEAKEVAKFERDKMRGDEVFELENYIAIRDPEQARQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.31
3 0.32
4 0.38
5 0.42
6 0.43
7 0.47
8 0.5
9 0.54
10 0.55
11 0.54
12 0.5
13 0.48
14 0.45
15 0.4
16 0.4
17 0.39
18 0.31
19 0.26
20 0.2
21 0.16
22 0.15
23 0.18
24 0.14
25 0.09
26 0.08
27 0.12
28 0.13
29 0.18
30 0.18
31 0.16
32 0.17
33 0.19
34 0.24
35 0.25
36 0.28
37 0.29
38 0.31
39 0.33
40 0.33
41 0.35
42 0.3
43 0.27
44 0.23
45 0.17
46 0.16
47 0.16
48 0.15
49 0.11
50 0.11
51 0.1
52 0.09
53 0.09
54 0.07
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.06
61 0.07
62 0.08
63 0.09
64 0.08
65 0.09
66 0.09
67 0.1
68 0.11
69 0.12
70 0.13
71 0.13
72 0.19
73 0.17
74 0.19
75 0.18
76 0.16
77 0.16
78 0.15
79 0.18
80 0.13
81 0.14
82 0.13
83 0.13
84 0.14
85 0.16
86 0.17
87 0.15
88 0.15
89 0.15
90 0.14
91 0.13
92 0.12
93 0.09
94 0.07
95 0.07
96 0.06
97 0.06
98 0.05
99 0.06
100 0.06
101 0.06
102 0.07
103 0.07
104 0.08
105 0.13
106 0.14
107 0.15
108 0.18
109 0.18
110 0.2
111 0.21
112 0.22
113 0.18
114 0.17
115 0.16
116 0.13
117 0.12
118 0.1
119 0.08
120 0.06
121 0.05
122 0.04
123 0.04
124 0.05
125 0.04
126 0.04
127 0.05
128 0.06
129 0.07
130 0.08
131 0.1
132 0.1
133 0.12
134 0.12
135 0.11
136 0.11
137 0.1
138 0.09
139 0.06
140 0.06
141 0.06
142 0.07
143 0.08
144 0.07
145 0.09
146 0.1
147 0.14
148 0.15
149 0.17
150 0.18
151 0.19
152 0.2
153 0.21
154 0.28
155 0.25
156 0.26
157 0.24
158 0.22
159 0.21
160 0.24
161 0.23
162 0.17
163 0.18
164 0.22
165 0.25
166 0.28
167 0.3
168 0.29
169 0.36
170 0.44
171 0.52
172 0.56
173 0.62
174 0.7
175 0.79
176 0.86
177 0.87
178 0.88
179 0.87
180 0.87
181 0.88
182 0.81
183 0.74
184 0.69
185 0.6
186 0.56
187 0.47
188 0.37
189 0.3
190 0.26
191 0.28
192 0.26
193 0.31
194 0.34
195 0.41
196 0.5
197 0.57
198 0.65
199 0.63
200 0.62
201 0.59
202 0.55
203 0.53
204 0.49
205 0.43
206 0.41
207 0.4
208 0.39
209 0.4
210 0.36
211 0.3
212 0.31
213 0.29
214 0.27
215 0.35
216 0.36
217 0.36
218 0.41
219 0.48
220 0.44
221 0.46
222 0.46
223 0.38
224 0.38
225 0.33
226 0.3
227 0.21
228 0.21
229 0.18
230 0.13
231 0.12
232 0.11
233 0.12
234 0.17
235 0.2