Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LJZ6

Protein Details
Accession A0A3N4LJZ6    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
57-79GELERLRRRRLERRERRLGAERGBasic
NLS Segment(s)
PositionSequence
61-76RLRRRRLERRERRLGA
Subcellular Location(s) cysk 10, nucl 8, cyto 6, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF09803  Pet100  
Amino Acid Sequences MGGSRLEVFKFGMYILFPIGIMYYFGTNLDERFAVPDFWPRKEETHRIPFEKDEIRGELERLRRRRLERRERRLGAERGGEGLGLQEDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.07
5 0.07
6 0.07
7 0.06
8 0.06
9 0.06
10 0.06
11 0.06
12 0.06
13 0.08
14 0.08
15 0.08
16 0.09
17 0.08
18 0.08
19 0.09
20 0.1
21 0.09
22 0.1
23 0.18
24 0.19
25 0.21
26 0.22
27 0.22
28 0.25
29 0.29
30 0.35
31 0.34
32 0.41
33 0.43
34 0.44
35 0.44
36 0.41
37 0.4
38 0.38
39 0.32
40 0.25
41 0.23
42 0.24
43 0.22
44 0.23
45 0.23
46 0.28
47 0.35
48 0.37
49 0.41
50 0.45
51 0.52
52 0.61
53 0.67
54 0.71
55 0.74
56 0.8
57 0.84
58 0.81
59 0.82
60 0.8
61 0.74
62 0.68
63 0.62
64 0.53
65 0.44
66 0.4
67 0.32
68 0.23
69 0.19