Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4L7R7

Protein Details
Accession A0A3N4L7R7    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MFTKSCKGRSRKGCMICKRKKIKCDEIHPRCQYFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
CDD cd00067  GAL4  
Amino Acid Sequences MFTKSCKGRSRKGCMICKRKKIKCDEIHPRCQYFQCQTSVLGDCSGRLGDSGFLDKRWLDIWLDIWLEIWLDIWLDLHRICWRRSCDPIGNRSQAASGVIVNPQWNEEGTDSLVNWRASGSEEGTGFFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.87
3 0.87
4 0.87
5 0.88
6 0.86
7 0.85
8 0.84
9 0.84
10 0.83
11 0.84
12 0.84
13 0.82
14 0.85
15 0.83
16 0.76
17 0.68
18 0.61
19 0.56
20 0.51
21 0.46
22 0.39
23 0.34
24 0.32
25 0.32
26 0.31
27 0.26
28 0.21
29 0.17
30 0.14
31 0.13
32 0.13
33 0.09
34 0.07
35 0.07
36 0.06
37 0.07
38 0.11
39 0.1
40 0.1
41 0.11
42 0.11
43 0.12
44 0.11
45 0.11
46 0.08
47 0.08
48 0.09
49 0.1
50 0.1
51 0.09
52 0.09
53 0.08
54 0.07
55 0.07
56 0.06
57 0.04
58 0.03
59 0.03
60 0.04
61 0.04
62 0.05
63 0.05
64 0.06
65 0.11
66 0.15
67 0.16
68 0.22
69 0.27
70 0.3
71 0.36
72 0.41
73 0.44
74 0.47
75 0.54
76 0.55
77 0.53
78 0.48
79 0.44
80 0.38
81 0.3
82 0.25
83 0.18
84 0.12
85 0.09
86 0.1
87 0.1
88 0.11
89 0.1
90 0.1
91 0.1
92 0.1
93 0.11
94 0.11
95 0.12
96 0.13
97 0.14
98 0.14
99 0.16
100 0.21
101 0.19
102 0.18
103 0.17
104 0.15
105 0.17
106 0.2
107 0.18
108 0.16
109 0.17