Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LHA0

Protein Details
Accession A0A3N4LHA0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
366-388PADERVWRKGKNKKPLPEAEGCGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13, mito 10, cyto_nucl 8.333, cyto_pero 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR007197  rSAM  
IPR013917  tRNA_wybutosine-synth  
IPR034556  tRNA_wybutosine-synthase  
Gene Ontology GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0046872  F:metal ion binding  
GO:0102521  F:tRNA-4-demethylwyosine synthase activity  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF04055  Radical_SAM  
PF08608  Wyosine_form  
PROSITE View protein in PROSITE  
PS51918  RADICAL_SAM  
CDD cd01335  Radical_SAM  
Amino Acid Sequences MVPKGGPTYNALTKQGYDIVGSHSGVKLCRWTKSALRGRGSCYKFSFYGIKSHLCMETTPSLSCSNKCVFCWRHGTNPVGTTWRWKVDPPEAIFAGVVDGHYRKIKMLKGVPGIRADRFAEAFRIRHCALSLVGEPIFYPFINEFLGMLHKSRISSFLVCNAQHPDELARLGPVTQLYVSIDASNKESLRKIDRPLHRDFWERFNRCLDILREKRNSHRTVFRLTLVKGFNIADEVRGYADLVEKALPCFVEIKGVTYCGTATTSKAGLTMSNVPFYEEVVEFVDALNGELATRGLGYGIAAEHAHSCCVLIASEKFKDGKGRWHTRIDYGKFFELVEGGKPFGPLDYVGEETPEWATWGNGGFDPADERVWRKGKNKKPLPEAEGCGDIGPPETDTMLVVVEVES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.29
4 0.23
5 0.2
6 0.22
7 0.23
8 0.23
9 0.21
10 0.2
11 0.22
12 0.22
13 0.22
14 0.27
15 0.27
16 0.31
17 0.32
18 0.36
19 0.41
20 0.51
21 0.59
22 0.58
23 0.63
24 0.62
25 0.66
26 0.7
27 0.67
28 0.62
29 0.57
30 0.53
31 0.45
32 0.46
33 0.47
34 0.38
35 0.43
36 0.4
37 0.4
38 0.36
39 0.38
40 0.36
41 0.3
42 0.29
43 0.25
44 0.27
45 0.26
46 0.25
47 0.24
48 0.27
49 0.29
50 0.29
51 0.29
52 0.3
53 0.3
54 0.31
55 0.39
56 0.37
57 0.41
58 0.49
59 0.47
60 0.5
61 0.53
62 0.55
63 0.49
64 0.48
65 0.44
66 0.39
67 0.36
68 0.34
69 0.33
70 0.33
71 0.3
72 0.31
73 0.34
74 0.38
75 0.45
76 0.42
77 0.43
78 0.39
79 0.38
80 0.35
81 0.29
82 0.22
83 0.14
84 0.11
85 0.07
86 0.08
87 0.09
88 0.12
89 0.12
90 0.14
91 0.19
92 0.22
93 0.28
94 0.33
95 0.38
96 0.44
97 0.48
98 0.49
99 0.5
100 0.49
101 0.42
102 0.39
103 0.34
104 0.27
105 0.24
106 0.22
107 0.21
108 0.22
109 0.23
110 0.21
111 0.26
112 0.24
113 0.24
114 0.23
115 0.19
116 0.17
117 0.19
118 0.18
119 0.15
120 0.14
121 0.13
122 0.13
123 0.12
124 0.13
125 0.09
126 0.1
127 0.07
128 0.08
129 0.09
130 0.09
131 0.08
132 0.07
133 0.1
134 0.09
135 0.1
136 0.1
137 0.11
138 0.11
139 0.11
140 0.13
141 0.14
142 0.16
143 0.16
144 0.21
145 0.24
146 0.24
147 0.26
148 0.26
149 0.24
150 0.22
151 0.22
152 0.16
153 0.13
154 0.13
155 0.11
156 0.08
157 0.08
158 0.08
159 0.08
160 0.07
161 0.06
162 0.06
163 0.06
164 0.06
165 0.07
166 0.07
167 0.07
168 0.08
169 0.08
170 0.1
171 0.11
172 0.11
173 0.12
174 0.13
175 0.15
176 0.21
177 0.24
178 0.28
179 0.34
180 0.41
181 0.45
182 0.49
183 0.51
184 0.47
185 0.5
186 0.47
187 0.48
188 0.51
189 0.48
190 0.45
191 0.42
192 0.4
193 0.34
194 0.36
195 0.3
196 0.3
197 0.33
198 0.39
199 0.42
200 0.43
201 0.5
202 0.55
203 0.55
204 0.49
205 0.51
206 0.46
207 0.46
208 0.46
209 0.41
210 0.37
211 0.34
212 0.36
213 0.29
214 0.26
215 0.22
216 0.2
217 0.17
218 0.15
219 0.14
220 0.09
221 0.08
222 0.09
223 0.07
224 0.07
225 0.07
226 0.06
227 0.07
228 0.07
229 0.07
230 0.08
231 0.08
232 0.08
233 0.09
234 0.08
235 0.07
236 0.09
237 0.08
238 0.12
239 0.12
240 0.15
241 0.14
242 0.15
243 0.15
244 0.14
245 0.14
246 0.09
247 0.11
248 0.09
249 0.09
250 0.11
251 0.11
252 0.1
253 0.11
254 0.1
255 0.09
256 0.11
257 0.18
258 0.17
259 0.19
260 0.19
261 0.2
262 0.19
263 0.19
264 0.19
265 0.11
266 0.12
267 0.11
268 0.11
269 0.1
270 0.1
271 0.1
272 0.07
273 0.08
274 0.07
275 0.05
276 0.05
277 0.05
278 0.05
279 0.04
280 0.04
281 0.04
282 0.04
283 0.04
284 0.04
285 0.04
286 0.04
287 0.05
288 0.05
289 0.06
290 0.08
291 0.08
292 0.09
293 0.08
294 0.08
295 0.07
296 0.08
297 0.08
298 0.09
299 0.12
300 0.16
301 0.18
302 0.2
303 0.21
304 0.22
305 0.29
306 0.28
307 0.35
308 0.41
309 0.5
310 0.52
311 0.6
312 0.61
313 0.62
314 0.7
315 0.64
316 0.61
317 0.56
318 0.53
319 0.45
320 0.43
321 0.34
322 0.26
323 0.22
324 0.18
325 0.15
326 0.14
327 0.14
328 0.14
329 0.14
330 0.13
331 0.13
332 0.1
333 0.11
334 0.13
335 0.14
336 0.14
337 0.15
338 0.15
339 0.15
340 0.15
341 0.13
342 0.11
343 0.09
344 0.09
345 0.09
346 0.11
347 0.12
348 0.11
349 0.12
350 0.12
351 0.12
352 0.15
353 0.14
354 0.15
355 0.15
356 0.18
357 0.25
358 0.32
359 0.38
360 0.44
361 0.53
362 0.61
363 0.7
364 0.77
365 0.78
366 0.82
367 0.84
368 0.83
369 0.81
370 0.76
371 0.68
372 0.61
373 0.52
374 0.42
375 0.32
376 0.25
377 0.19
378 0.15
379 0.12
380 0.1
381 0.1
382 0.1
383 0.1
384 0.1
385 0.09
386 0.08