Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4MC13

Protein Details
Accession A0A3N4MC13   
Localization Confidence High
Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
144-166DENLDRKKRTGGKAKGKGKVKLSBasic
NLS Segment(s)
PositionSequence
121-126KKNKRK
149-164RKKRTGGKAKGKGKVK
Subcellular Location(s) nucl 21, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSYNAKKSLRYEMEEPVFLRRLRQGQSGGEQQQRYIALRNKKRPIDDDEDAPTYVLDGGNDTITVEEFKALNSGKFGDDREDAEKDNMPATEEEAAAAEGTVVSLEKPLDTKEKILEAGSKKNKRKAVKMIGAEEGDDTIGQADENLDRKKRTGGKAKGKGKVKLSFGEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.47
3 0.42
4 0.41
5 0.35
6 0.35
7 0.32
8 0.34
9 0.34
10 0.39
11 0.37
12 0.36
13 0.42
14 0.47
15 0.48
16 0.48
17 0.45
18 0.39
19 0.39
20 0.37
21 0.32
22 0.32
23 0.32
24 0.36
25 0.46
26 0.56
27 0.61
28 0.64
29 0.67
30 0.64
31 0.64
32 0.63
33 0.56
34 0.5
35 0.45
36 0.42
37 0.39
38 0.34
39 0.26
40 0.17
41 0.15
42 0.11
43 0.07
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.05
50 0.05
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.09
57 0.09
58 0.09
59 0.09
60 0.1
61 0.1
62 0.11
63 0.12
64 0.12
65 0.12
66 0.14
67 0.16
68 0.16
69 0.16
70 0.16
71 0.17
72 0.14
73 0.14
74 0.12
75 0.1
76 0.09
77 0.1
78 0.09
79 0.08
80 0.08
81 0.07
82 0.07
83 0.06
84 0.05
85 0.04
86 0.03
87 0.03
88 0.03
89 0.02
90 0.02
91 0.03
92 0.03
93 0.04
94 0.05
95 0.07
96 0.11
97 0.12
98 0.14
99 0.15
100 0.17
101 0.17
102 0.18
103 0.22
104 0.21
105 0.3
106 0.39
107 0.46
108 0.51
109 0.58
110 0.64
111 0.64
112 0.69
113 0.7
114 0.7
115 0.7
116 0.69
117 0.65
118 0.61
119 0.56
120 0.47
121 0.37
122 0.27
123 0.18
124 0.13
125 0.09
126 0.06
127 0.05
128 0.05
129 0.05
130 0.05
131 0.09
132 0.15
133 0.2
134 0.23
135 0.25
136 0.27
137 0.35
138 0.42
139 0.48
140 0.53
141 0.59
142 0.67
143 0.76
144 0.83
145 0.83
146 0.83
147 0.81
148 0.78
149 0.75
150 0.68
151 0.64