Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LUP3

Protein Details
Accession A0A3N4LUP3    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
37-58SNEGRRPKPIDKARKARHRAAIBasic
NLS Segment(s)
PositionSequence
41-55RRPKPIDKARKARHR
Subcellular Location(s) cyto_nucl 14.5, cyto 14, nucl 11
Family & Domain DBs
Amino Acid Sequences MTPYSGNETPNQALLHLPDSSKGKFWPTPEYEVIIASNEGRRPKPIDKARKARHRAAIAMLEEIEGILNELGEIHTFLLNQACPDVTSILQIYKYHLKLSNFLQDGADNFLVYEMTNTGPVAVDADIKGLAEECELAKKMLQAIYYANYDAQRVRGFKNIFAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.18
4 0.17
5 0.17
6 0.21
7 0.22
8 0.23
9 0.23
10 0.26
11 0.28
12 0.3
13 0.36
14 0.36
15 0.41
16 0.4
17 0.42
18 0.36
19 0.33
20 0.31
21 0.23
22 0.18
23 0.14
24 0.15
25 0.15
26 0.19
27 0.19
28 0.22
29 0.26
30 0.3
31 0.39
32 0.46
33 0.54
34 0.61
35 0.71
36 0.77
37 0.82
38 0.84
39 0.81
40 0.79
41 0.72
42 0.63
43 0.56
44 0.51
45 0.41
46 0.35
47 0.27
48 0.19
49 0.15
50 0.13
51 0.09
52 0.04
53 0.04
54 0.03
55 0.03
56 0.02
57 0.03
58 0.03
59 0.03
60 0.03
61 0.04
62 0.04
63 0.04
64 0.05
65 0.06
66 0.06
67 0.06
68 0.06
69 0.05
70 0.05
71 0.06
72 0.06
73 0.05
74 0.06
75 0.07
76 0.07
77 0.08
78 0.08
79 0.11
80 0.16
81 0.17
82 0.18
83 0.22
84 0.23
85 0.24
86 0.28
87 0.33
88 0.28
89 0.28
90 0.25
91 0.21
92 0.21
93 0.23
94 0.19
95 0.11
96 0.1
97 0.1
98 0.09
99 0.09
100 0.08
101 0.05
102 0.05
103 0.06
104 0.06
105 0.06
106 0.06
107 0.06
108 0.07
109 0.06
110 0.07
111 0.06
112 0.07
113 0.07
114 0.07
115 0.07
116 0.06
117 0.06
118 0.05
119 0.06
120 0.06
121 0.1
122 0.11
123 0.12
124 0.12
125 0.13
126 0.16
127 0.18
128 0.18
129 0.15
130 0.17
131 0.2
132 0.2
133 0.2
134 0.19
135 0.18
136 0.19
137 0.19
138 0.21
139 0.23
140 0.24
141 0.26
142 0.33
143 0.34