Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4M1P5

Protein Details
Accession A0A3N4M1P5    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
34-60LSTLLNRKLHRARKQRKLDPTRPTKSLHydrophilic
NLS Segment(s)
PositionSequence
43-50HRARKQRK
Subcellular Location(s) cyto 16.5, cyto_nucl 13.5, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000308  14-3-3  
IPR036815  14-3-3_dom_sf  
IPR023410  14-3-3_domain  
Pfam View protein in Pfam  
PF00244  14-3-3  
Amino Acid Sequences MVSEVDQKYLGVFAKQTASKNPELSAALYKVLGLSTLLNRKLHRARKQRKLDPTRPTKSLDLYKHITWMGREGYTIIETILPHVDHFKGLRVLIYKLKASFLHVFVLFEFSPTTKVNVLSSIHARVASNATNAPNKELNYIRPAMEAFKKAYDLAEKSLPGIHPLRLSVIVEYSAFMFDCVKDYEESRRLAKKGVDEALEVVNVIEDDETFDDARDLVGSLAIMAKRVSPAVHQAASHGELKPRSSKTRTKVMYDLEGNELAPLPPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.27
4 0.32
5 0.37
6 0.4
7 0.41
8 0.39
9 0.36
10 0.34
11 0.34
12 0.32
13 0.27
14 0.23
15 0.21
16 0.2
17 0.17
18 0.15
19 0.12
20 0.08
21 0.09
22 0.14
23 0.21
24 0.25
25 0.28
26 0.29
27 0.37
28 0.46
29 0.53
30 0.57
31 0.62
32 0.69
33 0.76
34 0.86
35 0.87
36 0.89
37 0.9
38 0.88
39 0.88
40 0.88
41 0.84
42 0.76
43 0.71
44 0.63
45 0.59
46 0.59
47 0.53
48 0.49
49 0.47
50 0.44
51 0.43
52 0.41
53 0.36
54 0.28
55 0.27
56 0.23
57 0.18
58 0.18
59 0.15
60 0.15
61 0.14
62 0.14
63 0.1
64 0.09
65 0.08
66 0.09
67 0.11
68 0.1
69 0.09
70 0.11
71 0.11
72 0.11
73 0.12
74 0.14
75 0.14
76 0.14
77 0.16
78 0.16
79 0.18
80 0.21
81 0.22
82 0.21
83 0.2
84 0.22
85 0.2
86 0.23
87 0.23
88 0.2
89 0.21
90 0.19
91 0.19
92 0.16
93 0.2
94 0.15
95 0.12
96 0.11
97 0.09
98 0.11
99 0.12
100 0.13
101 0.11
102 0.11
103 0.11
104 0.14
105 0.14
106 0.14
107 0.15
108 0.15
109 0.14
110 0.14
111 0.14
112 0.12
113 0.13
114 0.12
115 0.11
116 0.11
117 0.13
118 0.15
119 0.15
120 0.17
121 0.17
122 0.16
123 0.19
124 0.18
125 0.18
126 0.19
127 0.2
128 0.18
129 0.16
130 0.16
131 0.16
132 0.17
133 0.17
134 0.15
135 0.14
136 0.15
137 0.14
138 0.15
139 0.15
140 0.14
141 0.15
142 0.16
143 0.15
144 0.15
145 0.17
146 0.16
147 0.16
148 0.16
149 0.15
150 0.14
151 0.14
152 0.15
153 0.13
154 0.14
155 0.11
156 0.1
157 0.09
158 0.08
159 0.08
160 0.07
161 0.07
162 0.06
163 0.06
164 0.06
165 0.05
166 0.08
167 0.09
168 0.1
169 0.1
170 0.12
171 0.19
172 0.23
173 0.25
174 0.28
175 0.33
176 0.32
177 0.35
178 0.37
179 0.35
180 0.36
181 0.37
182 0.33
183 0.28
184 0.29
185 0.26
186 0.23
187 0.17
188 0.11
189 0.08
190 0.07
191 0.06
192 0.04
193 0.03
194 0.05
195 0.06
196 0.08
197 0.08
198 0.08
199 0.08
200 0.08
201 0.09
202 0.07
203 0.07
204 0.05
205 0.05
206 0.05
207 0.05
208 0.08
209 0.08
210 0.09
211 0.08
212 0.09
213 0.1
214 0.11
215 0.12
216 0.11
217 0.18
218 0.23
219 0.24
220 0.23
221 0.24
222 0.27
223 0.29
224 0.3
225 0.24
226 0.24
227 0.25
228 0.28
229 0.35
230 0.37
231 0.43
232 0.47
233 0.54
234 0.56
235 0.64
236 0.65
237 0.64
238 0.64
239 0.62
240 0.63
241 0.58
242 0.54
243 0.47
244 0.43
245 0.37
246 0.31
247 0.26