Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LMA6

Protein Details
Accession A0A3N4LMA6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
8-28RLPPLPKLRIRRPNKEASNPCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MPGEKVFRLPPLPKLRIRRPNKEASNPCLGVMTAVLGCWASKGHQSGIEGCGKLEEALRVCMDTKKAAAPRKSTINYHLSRLYPKLIGPHKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.67
3 0.71
4 0.77
5 0.78
6 0.76
7 0.8
8 0.8
9 0.81
10 0.77
11 0.72
12 0.72
13 0.62
14 0.55
15 0.45
16 0.37
17 0.26
18 0.19
19 0.15
20 0.06
21 0.05
22 0.05
23 0.04
24 0.04
25 0.04
26 0.05
27 0.04
28 0.07
29 0.09
30 0.09
31 0.11
32 0.12
33 0.13
34 0.16
35 0.18
36 0.16
37 0.14
38 0.13
39 0.12
40 0.11
41 0.1
42 0.1
43 0.08
44 0.09
45 0.1
46 0.1
47 0.11
48 0.13
49 0.14
50 0.13
51 0.13
52 0.17
53 0.24
54 0.31
55 0.36
56 0.39
57 0.42
58 0.5
59 0.52
60 0.5
61 0.49
62 0.51
63 0.48
64 0.47
65 0.47
66 0.41
67 0.42
68 0.41
69 0.39
70 0.31
71 0.3
72 0.35
73 0.4