Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LI97

Protein Details
Accession A0A3N4LI97    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-37DLATCRGPSCRRNQKKNNNNNKKGGSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MFTSETRKADTDLATCRGPSCRRNQKKNNNNNKKGGSNKTKDLSANYHSIATLTAYTLYLPAFSVECVLLWHCD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.27
4 0.29
5 0.32
6 0.33
7 0.38
8 0.46
9 0.56
10 0.66
11 0.76
12 0.8
13 0.86
14 0.92
15 0.93
16 0.92
17 0.89
18 0.85
19 0.78
20 0.73
21 0.69
22 0.66
23 0.64
24 0.56
25 0.54
26 0.49
27 0.47
28 0.42
29 0.39
30 0.35
31 0.29
32 0.28
33 0.24
34 0.22
35 0.2
36 0.19
37 0.16
38 0.13
39 0.1
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.06
47 0.06
48 0.07
49 0.07
50 0.07
51 0.08
52 0.08
53 0.08
54 0.09