Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4M0L1

Protein Details
Accession A0A3N4M0L1    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
162-182YKCHTHPKIKDAPKRRRESSSBasic
NLS Segment(s)
PositionSequence
171-179KDAPKRRRE
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, mito 8, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028012  Rua1_C  
Pfam View protein in Pfam  
PF14616  Rua1_C  
Amino Acid Sequences MIGYPYIRRILGSNVESSHSNYADLADPPDLYASLQEEQIPPAPEDMNPEEPDMKPHEQELRFEGDLYTPRWVRGHGNKREGWCGICKPGRWLVLKNSAFWYDKSFTHGISAATGQQFVVPKEVRRMDGNPDVWKGLCHSCNDWVSLVSNKKKGTTWFRHAYKCHTHPKIKDAPKRRRESSSNKAAAAAASVAKAKPDASSSEVVVAGIVNSIKAERGWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.31
4 0.33
5 0.31
6 0.24
7 0.22
8 0.18
9 0.19
10 0.19
11 0.19
12 0.18
13 0.14
14 0.14
15 0.14
16 0.14
17 0.12
18 0.1
19 0.1
20 0.11
21 0.11
22 0.12
23 0.13
24 0.13
25 0.15
26 0.19
27 0.2
28 0.17
29 0.18
30 0.18
31 0.16
32 0.22
33 0.24
34 0.25
35 0.24
36 0.26
37 0.26
38 0.25
39 0.28
40 0.29
41 0.26
42 0.22
43 0.24
44 0.3
45 0.29
46 0.31
47 0.31
48 0.31
49 0.28
50 0.28
51 0.25
52 0.2
53 0.21
54 0.21
55 0.23
56 0.17
57 0.18
58 0.19
59 0.2
60 0.24
61 0.32
62 0.41
63 0.44
64 0.5
65 0.52
66 0.54
67 0.56
68 0.5
69 0.42
70 0.36
71 0.29
72 0.3
73 0.3
74 0.28
75 0.28
76 0.32
77 0.35
78 0.33
79 0.34
80 0.32
81 0.39
82 0.39
83 0.37
84 0.34
85 0.33
86 0.31
87 0.29
88 0.28
89 0.2
90 0.2
91 0.23
92 0.22
93 0.18
94 0.18
95 0.19
96 0.14
97 0.12
98 0.12
99 0.1
100 0.09
101 0.09
102 0.08
103 0.08
104 0.09
105 0.09
106 0.13
107 0.12
108 0.13
109 0.19
110 0.21
111 0.21
112 0.22
113 0.24
114 0.25
115 0.31
116 0.33
117 0.29
118 0.29
119 0.28
120 0.25
121 0.24
122 0.21
123 0.19
124 0.18
125 0.18
126 0.18
127 0.23
128 0.24
129 0.25
130 0.22
131 0.18
132 0.18
133 0.22
134 0.27
135 0.27
136 0.31
137 0.3
138 0.32
139 0.33
140 0.39
141 0.43
142 0.45
143 0.49
144 0.54
145 0.59
146 0.65
147 0.65
148 0.65
149 0.65
150 0.64
151 0.65
152 0.64
153 0.66
154 0.62
155 0.69
156 0.71
157 0.72
158 0.73
159 0.74
160 0.76
161 0.79
162 0.84
163 0.8
164 0.78
165 0.77
166 0.77
167 0.77
168 0.77
169 0.71
170 0.63
171 0.59
172 0.5
173 0.42
174 0.33
175 0.24
176 0.14
177 0.11
178 0.12
179 0.11
180 0.11
181 0.12
182 0.11
183 0.11
184 0.13
185 0.15
186 0.18
187 0.2
188 0.2
189 0.22
190 0.21
191 0.2
192 0.17
193 0.14
194 0.1
195 0.09
196 0.08
197 0.06
198 0.06
199 0.07
200 0.08