Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LTZ3

Protein Details
Accession A0A3N4LTZ3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MARQAKGTKKAKKPDKTGPLSVHydrophilic
105-127YNNGQRRSGRAKARPKRLLDEKDHydrophilic
NLS Segment(s)
PositionSequence
7-14GTKKAKKP
110-121RRSGRAKARPKR
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MARQAKGTKKAKKPDKTGPLSVAAIVATQSTPRSRVNWRVQLNLPAAPVVVPPAPAGPRPRLPQQAPANSTAAARRTAQAARAAAMAAQDVWDLQQQAYENAVAYNNGQRRSGRAKARPKRLLDEKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.83
4 0.79
5 0.71
6 0.65
7 0.56
8 0.48
9 0.37
10 0.26
11 0.19
12 0.14
13 0.11
14 0.06
15 0.06
16 0.08
17 0.09
18 0.12
19 0.14
20 0.18
21 0.23
22 0.33
23 0.42
24 0.49
25 0.51
26 0.53
27 0.53
28 0.56
29 0.51
30 0.43
31 0.34
32 0.24
33 0.21
34 0.16
35 0.14
36 0.09
37 0.07
38 0.06
39 0.06
40 0.08
41 0.08
42 0.11
43 0.14
44 0.16
45 0.2
46 0.23
47 0.28
48 0.33
49 0.34
50 0.4
51 0.44
52 0.47
53 0.45
54 0.43
55 0.39
56 0.33
57 0.32
58 0.25
59 0.2
60 0.15
61 0.14
62 0.12
63 0.14
64 0.14
65 0.16
66 0.18
67 0.17
68 0.16
69 0.16
70 0.15
71 0.13
72 0.12
73 0.1
74 0.05
75 0.05
76 0.04
77 0.04
78 0.05
79 0.06
80 0.07
81 0.07
82 0.09
83 0.09
84 0.1
85 0.12
86 0.11
87 0.1
88 0.1
89 0.1
90 0.09
91 0.1
92 0.16
93 0.2
94 0.21
95 0.24
96 0.24
97 0.3
98 0.37
99 0.44
100 0.47
101 0.52
102 0.61
103 0.69
104 0.79
105 0.82
106 0.8
107 0.81