Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LRS7

Protein Details
Accession A0A3N4LRS7    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
351-370ALRGWFKARKEKGRVLPEMFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 3, cyto 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR033122  LETM1-like_RBD  
IPR044202  LETM1/MDM38-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0043022  F:ribosome binding  
Pfam View protein in Pfam  
PF07766  LETM1_RBD  
Amino Acid Sequences MRALRTSVPLRTLQQPNSTLPCRAPVLFKPQLYTPYTRTSIHNHGSYLRTFYTTSPTLQSLSPQPTSPPSAQVEITTGKLAAPNTTLPGDLETPERLKDDSAIGYYFKVGKGYLSFYKTGLKNVYRNFVASRDLQKRIDTEGKGSITELVDQGKITRGEFQFVMRTRHDSRRIPLFALMFLICGEFTPLVVITFSSVVPFPCRIPKQMNSDKAKLHQRRTASFSALPPPPITNPSQQPATTAHTSTPALTKALTTIPPVLDLTHLTHQQLMHVAITLNLAPSISSYVAFPYLLQRRVSRKLEYLELDDTLIERFGGMDALVKEGGRKELEWAAMERGIDTLNRKDWELQVALRGWFKARKEKGRVLPEMFFERR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.53
4 0.57
5 0.56
6 0.49
7 0.43
8 0.42
9 0.38
10 0.36
11 0.36
12 0.33
13 0.4
14 0.44
15 0.44
16 0.42
17 0.42
18 0.47
19 0.46
20 0.46
21 0.4
22 0.41
23 0.43
24 0.42
25 0.42
26 0.43
27 0.47
28 0.49
29 0.47
30 0.41
31 0.42
32 0.44
33 0.42
34 0.39
35 0.31
36 0.27
37 0.25
38 0.24
39 0.27
40 0.25
41 0.26
42 0.25
43 0.25
44 0.24
45 0.23
46 0.26
47 0.25
48 0.29
49 0.29
50 0.26
51 0.27
52 0.29
53 0.34
54 0.32
55 0.31
56 0.28
57 0.29
58 0.28
59 0.27
60 0.26
61 0.23
62 0.23
63 0.18
64 0.15
65 0.13
66 0.15
67 0.14
68 0.12
69 0.13
70 0.12
71 0.14
72 0.14
73 0.14
74 0.12
75 0.14
76 0.14
77 0.13
78 0.14
79 0.15
80 0.15
81 0.16
82 0.17
83 0.15
84 0.15
85 0.15
86 0.15
87 0.14
88 0.14
89 0.14
90 0.14
91 0.13
92 0.15
93 0.15
94 0.12
95 0.12
96 0.1
97 0.1
98 0.11
99 0.16
100 0.19
101 0.21
102 0.21
103 0.21
104 0.28
105 0.28
106 0.3
107 0.32
108 0.31
109 0.34
110 0.36
111 0.41
112 0.34
113 0.35
114 0.32
115 0.28
116 0.26
117 0.24
118 0.3
119 0.31
120 0.34
121 0.34
122 0.34
123 0.34
124 0.36
125 0.39
126 0.31
127 0.28
128 0.29
129 0.28
130 0.26
131 0.25
132 0.22
133 0.15
134 0.15
135 0.14
136 0.1
137 0.1
138 0.09
139 0.1
140 0.12
141 0.12
142 0.11
143 0.17
144 0.16
145 0.18
146 0.18
147 0.19
148 0.22
149 0.24
150 0.27
151 0.22
152 0.27
153 0.3
154 0.37
155 0.43
156 0.4
157 0.41
158 0.46
159 0.46
160 0.42
161 0.4
162 0.32
163 0.26
164 0.23
165 0.2
166 0.11
167 0.09
168 0.08
169 0.06
170 0.05
171 0.05
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.05
181 0.05
182 0.05
183 0.05
184 0.06
185 0.07
186 0.08
187 0.09
188 0.15
189 0.17
190 0.2
191 0.25
192 0.3
193 0.38
194 0.45
195 0.53
196 0.52
197 0.55
198 0.53
199 0.54
200 0.59
201 0.56
202 0.54
203 0.49
204 0.48
205 0.48
206 0.52
207 0.48
208 0.42
209 0.37
210 0.34
211 0.35
212 0.33
213 0.3
214 0.24
215 0.23
216 0.21
217 0.21
218 0.22
219 0.21
220 0.23
221 0.25
222 0.27
223 0.25
224 0.26
225 0.26
226 0.29
227 0.26
228 0.23
229 0.2
230 0.2
231 0.21
232 0.2
233 0.19
234 0.15
235 0.13
236 0.12
237 0.12
238 0.11
239 0.13
240 0.13
241 0.12
242 0.13
243 0.13
244 0.14
245 0.14
246 0.13
247 0.12
248 0.12
249 0.14
250 0.16
251 0.17
252 0.16
253 0.18
254 0.18
255 0.18
256 0.19
257 0.16
258 0.12
259 0.12
260 0.12
261 0.1
262 0.11
263 0.1
264 0.08
265 0.07
266 0.06
267 0.05
268 0.06
269 0.08
270 0.07
271 0.07
272 0.07
273 0.08
274 0.09
275 0.09
276 0.09
277 0.15
278 0.22
279 0.25
280 0.28
281 0.32
282 0.38
283 0.47
284 0.51
285 0.47
286 0.46
287 0.46
288 0.5
289 0.48
290 0.45
291 0.38
292 0.34
293 0.3
294 0.25
295 0.21
296 0.16
297 0.13
298 0.08
299 0.06
300 0.05
301 0.05
302 0.06
303 0.05
304 0.09
305 0.09
306 0.11
307 0.12
308 0.12
309 0.13
310 0.15
311 0.19
312 0.16
313 0.16
314 0.18
315 0.21
316 0.24
317 0.24
318 0.25
319 0.24
320 0.24
321 0.24
322 0.2
323 0.17
324 0.16
325 0.16
326 0.18
327 0.2
328 0.25
329 0.26
330 0.28
331 0.31
332 0.33
333 0.36
334 0.35
335 0.31
336 0.3
337 0.32
338 0.33
339 0.32
340 0.3
341 0.29
342 0.32
343 0.35
344 0.4
345 0.47
346 0.55
347 0.61
348 0.7
349 0.75
350 0.79
351 0.82
352 0.77
353 0.71
354 0.66