Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LQP6

Protein Details
Accession A0A3N4LQP6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
62-89DDGETAKEERRRRRRREERKCPIPRGGGBasic
NLS Segment(s)
PositionSequence
69-81EERRRRRRREERK
Subcellular Location(s) plas 8, extr 7, E.R. 4, mito 3, golg 3
Family & Domain DBs
Amino Acid Sequences MPPHLHPRSLSTTSLFSTTLALAFMVVAVPHILPCPVRGPPWGYRVDATGSQEEEGDKFYKDDGETAKEERRRRRRREERKCPIPRGGGGLVEELRKWMGGTSEGEGVREVVFEKRLGGSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.27
3 0.19
4 0.17
5 0.16
6 0.13
7 0.1
8 0.09
9 0.07
10 0.06
11 0.06
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.05
19 0.06
20 0.06
21 0.07
22 0.1
23 0.11
24 0.12
25 0.14
26 0.19
27 0.23
28 0.28
29 0.29
30 0.27
31 0.26
32 0.26
33 0.27
34 0.24
35 0.22
36 0.18
37 0.16
38 0.15
39 0.15
40 0.14
41 0.11
42 0.11
43 0.1
44 0.08
45 0.08
46 0.08
47 0.09
48 0.09
49 0.1
50 0.1
51 0.13
52 0.14
53 0.16
54 0.22
55 0.26
56 0.32
57 0.41
58 0.51
59 0.58
60 0.65
61 0.74
62 0.8
63 0.86
64 0.92
65 0.93
66 0.92
67 0.93
68 0.93
69 0.87
70 0.82
71 0.75
72 0.65
73 0.59
74 0.49
75 0.4
76 0.31
77 0.28
78 0.23
79 0.2
80 0.18
81 0.13
82 0.12
83 0.11
84 0.1
85 0.08
86 0.09
87 0.1
88 0.13
89 0.14
90 0.19
91 0.19
92 0.2
93 0.19
94 0.19
95 0.16
96 0.14
97 0.13
98 0.11
99 0.13
100 0.12
101 0.14