Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4M5A0

Protein Details
Accession A0A3N4M5A0    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKKAAKPQGPKKREPLATBasic
NLS Segment(s)
PositionSequence
3-16KRKKAAKPQGPKKR
Subcellular Location(s) cyto 11.5cyto_mito 11.5, mito 10.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKAAKPQGPKKREPLATTFACLFCNHEKSISCKLDKKASVGTLACKVCGQTFQTDINALSAPVDVYSDWIDACDAVTREN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.76
4 0.69
5 0.64
6 0.6
7 0.54
8 0.5
9 0.44
10 0.35
11 0.3
12 0.26
13 0.24
14 0.22
15 0.24
16 0.21
17 0.22
18 0.22
19 0.26
20 0.36
21 0.35
22 0.34
23 0.36
24 0.38
25 0.43
26 0.43
27 0.4
28 0.34
29 0.3
30 0.3
31 0.25
32 0.25
33 0.24
34 0.23
35 0.2
36 0.17
37 0.17
38 0.14
39 0.16
40 0.16
41 0.12
42 0.15
43 0.16
44 0.17
45 0.17
46 0.17
47 0.16
48 0.14
49 0.12
50 0.1
51 0.08
52 0.07
53 0.06
54 0.07
55 0.05
56 0.07
57 0.09
58 0.09
59 0.08
60 0.09
61 0.09
62 0.08
63 0.09
64 0.12