Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LZK3

Protein Details
Accession A0A3N4LZK3    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
18-46TLLPKPFKSPHWKPPSRRNKNLKQILQEDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 7, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MAPQQPIPNPILDPLDITLLPKPFKSPHWKPPSRRNKNLKQILQEDLKTLTTNPTTTTTTTTTTAATTSSSSPPSSTNPGAVGATYTNIESAPSFHPARAHWCDITGLPSKYMDPRTKLRYADVEVYRAIRELPPGGKEGYLELRGANVVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.16
4 0.17
5 0.18
6 0.19
7 0.2
8 0.19
9 0.21
10 0.21
11 0.29
12 0.38
13 0.42
14 0.49
15 0.6
16 0.68
17 0.72
18 0.8
19 0.84
20 0.85
21 0.87
22 0.86
23 0.86
24 0.88
25 0.9
26 0.85
27 0.81
28 0.74
29 0.69
30 0.64
31 0.54
32 0.44
33 0.36
34 0.31
35 0.24
36 0.2
37 0.18
38 0.15
39 0.14
40 0.15
41 0.16
42 0.17
43 0.18
44 0.21
45 0.19
46 0.2
47 0.2
48 0.19
49 0.16
50 0.15
51 0.14
52 0.11
53 0.1
54 0.09
55 0.09
56 0.1
57 0.11
58 0.11
59 0.11
60 0.13
61 0.14
62 0.18
63 0.16
64 0.15
65 0.14
66 0.15
67 0.14
68 0.13
69 0.11
70 0.07
71 0.07
72 0.06
73 0.06
74 0.05
75 0.05
76 0.06
77 0.05
78 0.07
79 0.08
80 0.13
81 0.13
82 0.13
83 0.15
84 0.16
85 0.24
86 0.26
87 0.28
88 0.23
89 0.24
90 0.24
91 0.23
92 0.27
93 0.25
94 0.21
95 0.18
96 0.19
97 0.19
98 0.23
99 0.3
100 0.3
101 0.3
102 0.36
103 0.42
104 0.47
105 0.47
106 0.46
107 0.45
108 0.44
109 0.48
110 0.43
111 0.38
112 0.34
113 0.35
114 0.31
115 0.26
116 0.22
117 0.15
118 0.15
119 0.17
120 0.19
121 0.2
122 0.22
123 0.22
124 0.21
125 0.21
126 0.22
127 0.24
128 0.22
129 0.2
130 0.18
131 0.18