Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LD82

Protein Details
Accession A0A3N4LD82    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
7-29TGGARGGVRRKARKSKQQDEEDVHydrophilic
NLS Segment(s)
PositionSequence
11-21RGGVRRKARKS
Subcellular Location(s) mito 23, pero 2
Family & Domain DBs
Amino Acid Sequences MASRPETGGARGGVRRKARKSKQQDEEDVGSFWFFSLRAARCLCPVSFAVFCVPPGLGRVRVDAVQRRAGQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.49
3 0.54
4 0.64
5 0.69
6 0.75
7 0.81
8 0.84
9 0.85
10 0.84
11 0.8
12 0.74
13 0.68
14 0.59
15 0.49
16 0.38
17 0.28
18 0.2
19 0.14
20 0.09
21 0.05
22 0.05
23 0.1
24 0.11
25 0.14
26 0.16
27 0.17
28 0.19
29 0.21
30 0.2
31 0.17
32 0.17
33 0.17
34 0.15
35 0.16
36 0.16
37 0.14
38 0.15
39 0.13
40 0.12
41 0.09
42 0.11
43 0.14
44 0.15
45 0.16
46 0.18
47 0.2
48 0.23
49 0.29
50 0.35
51 0.37
52 0.41