Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LVH7

Protein Details
Accession A0A3N4LVH7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
29-60RVRGRGKRKLKIKIKIKKRPTLSQKHKRGGTKBasic
NLS Segment(s)
PositionSequence
29-60RVRGRGKRKLKIKIKIKKRPTLSQKHKRGGTK
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
Amino Acid Sequences MYLVWLALAPPRRVCTYVPNAATRNQEIRVRGRGKRKLKIKIKIKKRPTLSQKHKRGGTKFINAKRLISSGLGVMLLDLKFMGGILPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.36
4 0.42
5 0.42
6 0.44
7 0.43
8 0.45
9 0.48
10 0.42
11 0.37
12 0.33
13 0.33
14 0.31
15 0.34
16 0.39
17 0.41
18 0.43
19 0.5
20 0.56
21 0.61
22 0.66
23 0.69
24 0.71
25 0.75
26 0.78
27 0.79
28 0.79
29 0.82
30 0.83
31 0.83
32 0.8
33 0.77
34 0.76
35 0.76
36 0.78
37 0.78
38 0.79
39 0.8
40 0.8
41 0.8
42 0.78
43 0.72
44 0.7
45 0.66
46 0.65
47 0.64
48 0.62
49 0.65
50 0.59
51 0.57
52 0.49
53 0.43
54 0.35
55 0.27
56 0.21
57 0.14
58 0.13
59 0.12
60 0.09
61 0.08
62 0.09
63 0.08
64 0.08
65 0.07
66 0.06
67 0.06
68 0.06