Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LC88

Protein Details
Accession A0A3N4LC88    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-45DGLDQRERVRRWKREKEKLRELIREKKKKCBasic
NLS Segment(s)
PositionSequence
21-44RERVRRWKREKEKLRELIREKKKK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
Amino Acid Sequences MQLKVTWRSRRERLGDGLDQRERVRRWKREKEKLRELIREKKKKCWQRFYEEMGRKDQWEVAKWAKDLWRLKGVIGVLRNEDREEYKEDEEKRASLVKNHFKWREEGRIEEEEKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.64
3 0.61
4 0.62
5 0.55
6 0.52
7 0.48
8 0.48
9 0.43
10 0.46
11 0.5
12 0.52
13 0.6
14 0.69
15 0.78
16 0.82
17 0.9
18 0.9
19 0.91
20 0.9
21 0.87
22 0.85
23 0.8
24 0.8
25 0.8
26 0.8
27 0.72
28 0.73
29 0.75
30 0.76
31 0.79
32 0.79
33 0.75
34 0.74
35 0.78
36 0.75
37 0.76
38 0.72
39 0.64
40 0.59
41 0.52
42 0.44
43 0.38
44 0.33
45 0.24
46 0.19
47 0.21
48 0.2
49 0.22
50 0.22
51 0.23
52 0.23
53 0.29
54 0.3
55 0.3
56 0.32
57 0.29
58 0.29
59 0.3
60 0.28
61 0.24
62 0.23
63 0.2
64 0.18
65 0.19
66 0.2
67 0.18
68 0.19
69 0.17
70 0.18
71 0.21
72 0.22
73 0.24
74 0.3
75 0.31
76 0.35
77 0.35
78 0.32
79 0.31
80 0.32
81 0.3
82 0.31
83 0.39
84 0.44
85 0.5
86 0.59
87 0.62
88 0.59
89 0.64
90 0.64
91 0.64
92 0.58
93 0.56
94 0.53
95 0.55