Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4M2N5

Protein Details
Accession A0A3N4M2N5    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
42-72RTRTILKNSKKTLKKHKKNQPSHREREPPFFBasic
NLS Segment(s)
PositionSequence
48-65KNSKKTLKKHKKNQPSHR
Subcellular Location(s) mito 22, nucl 5
Family & Domain DBs
Amino Acid Sequences MNTNCPRLLGLWRWSLHIWVIWLWWGRIVCSIHLAPKTLTPRTRTILKNSKKTLKKHKKNQPSHREREPPFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.3
4 0.24
5 0.2
6 0.13
7 0.13
8 0.13
9 0.14
10 0.12
11 0.14
12 0.13
13 0.12
14 0.16
15 0.17
16 0.14
17 0.16
18 0.17
19 0.17
20 0.18
21 0.19
22 0.14
23 0.18
24 0.22
25 0.23
26 0.25
27 0.26
28 0.29
29 0.31
30 0.39
31 0.37
32 0.42
33 0.49
34 0.54
35 0.59
36 0.63
37 0.69
38 0.69
39 0.75
40 0.77
41 0.78
42 0.81
43 0.83
44 0.87
45 0.88
46 0.92
47 0.94
48 0.94
49 0.93
50 0.91
51 0.91
52 0.9