Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4M0K7

Protein Details
Accession A0A3N4M0K7   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-30SLDSNQKAPLKRKRPNVKGNYGDYPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR026489  CXC_dom  
IPR045318  EZH1/2-like  
IPR041355  Pre-SET_CXC  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
Gene Ontology GO:0140951  F:histone H3K27 trimethyltransferase activity  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF18264  preSET_CXC  
PF00856  SET  
PROSITE View protein in PROSITE  
PS51633  CXC  
PS50280  SET  
CDD cd10519  SET_EZH  
Amino Acid Sequences MADVESLDSNQKAPLKRKRPNVKGNYGDYPADCHKTLNSNERSYFKPCLHTGPCNSECPCVKDKVMCEKTCMCDADCPRKWRGCKCIASGKACSITTACPCARWNRECDPDLCSGCGAAETLSPTNRYDLELAKECCQNVVIQRDIPKRTLLGVSGVSGLGLFIGENVKKDGFLGEYKGEIISNDEAERRGKLYDRRGVSFLFTLNKTQVIDATRAGNKFRFVNHYKKPNCFARVLFTNCTHRIGMFAKRDLVAGEELYFDYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.54
3 0.62
4 0.73
5 0.79
6 0.85
7 0.89
8 0.89
9 0.89
10 0.86
11 0.84
12 0.79
13 0.72
14 0.63
15 0.52
16 0.48
17 0.42
18 0.38
19 0.32
20 0.27
21 0.26
22 0.31
23 0.36
24 0.41
25 0.43
26 0.44
27 0.48
28 0.5
29 0.52
30 0.5
31 0.5
32 0.43
33 0.43
34 0.38
35 0.43
36 0.45
37 0.48
38 0.48
39 0.51
40 0.51
41 0.5
42 0.5
43 0.47
44 0.44
45 0.43
46 0.41
47 0.36
48 0.34
49 0.33
50 0.37
51 0.42
52 0.48
53 0.44
54 0.45
55 0.46
56 0.47
57 0.47
58 0.43
59 0.33
60 0.32
61 0.37
62 0.43
63 0.45
64 0.46
65 0.46
66 0.52
67 0.56
68 0.56
69 0.59
70 0.57
71 0.56
72 0.58
73 0.63
74 0.62
75 0.61
76 0.56
77 0.5
78 0.45
79 0.39
80 0.34
81 0.25
82 0.22
83 0.19
84 0.22
85 0.19
86 0.17
87 0.19
88 0.25
89 0.31
90 0.32
91 0.36
92 0.37
93 0.43
94 0.43
95 0.42
96 0.39
97 0.37
98 0.35
99 0.29
100 0.23
101 0.17
102 0.15
103 0.14
104 0.1
105 0.05
106 0.05
107 0.06
108 0.07
109 0.08
110 0.09
111 0.09
112 0.1
113 0.1
114 0.11
115 0.11
116 0.11
117 0.14
118 0.19
119 0.2
120 0.21
121 0.22
122 0.21
123 0.2
124 0.19
125 0.16
126 0.14
127 0.17
128 0.15
129 0.16
130 0.23
131 0.29
132 0.3
133 0.3
134 0.27
135 0.23
136 0.23
137 0.22
138 0.16
139 0.12
140 0.11
141 0.11
142 0.1
143 0.1
144 0.08
145 0.07
146 0.06
147 0.04
148 0.03
149 0.03
150 0.02
151 0.05
152 0.05
153 0.06
154 0.08
155 0.08
156 0.08
157 0.09
158 0.09
159 0.09
160 0.1
161 0.12
162 0.11
163 0.12
164 0.12
165 0.12
166 0.11
167 0.09
168 0.11
169 0.1
170 0.1
171 0.11
172 0.11
173 0.13
174 0.14
175 0.15
176 0.13
177 0.13
178 0.17
179 0.23
180 0.31
181 0.37
182 0.4
183 0.42
184 0.43
185 0.42
186 0.39
187 0.34
188 0.28
189 0.25
190 0.22
191 0.21
192 0.21
193 0.22
194 0.2
195 0.19
196 0.19
197 0.17
198 0.18
199 0.17
200 0.22
201 0.24
202 0.25
203 0.27
204 0.26
205 0.27
206 0.27
207 0.29
208 0.33
209 0.34
210 0.43
211 0.49
212 0.58
213 0.61
214 0.65
215 0.7
216 0.69
217 0.68
218 0.63
219 0.56
220 0.53
221 0.56
222 0.54
223 0.52
224 0.48
225 0.52
226 0.49
227 0.51
228 0.43
229 0.34
230 0.34
231 0.33
232 0.36
233 0.35
234 0.36
235 0.36
236 0.36
237 0.37
238 0.32
239 0.31
240 0.25
241 0.19
242 0.16
243 0.14