Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LS15

Protein Details
Accession A0A3N4LS15   
Localization Confidence High
Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-32VEAEEEKKFRRGRKRIRQRMPKASRVGSBasic
NLS Segment(s)
PositionSequence
11-29KKFRRGRKRIRQRMPKASR
102-107RKSKSK
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039754  Esf1  
IPR012580  NUC153  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF08159  NUC153  
Amino Acid Sequences MKEVVEAEEEKKFRRGRKRIRQRMPKASRVGSRLMSKIYRFAALFEEHEFAIDPTNPRFKQTTTMKKKNQADNSENGPNRKKWKAEMQAGDDVSRLVQSLKRKSKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.59
3 0.63
4 0.73
5 0.82
6 0.86
7 0.92
8 0.95
9 0.94
10 0.94
11 0.91
12 0.88
13 0.83
14 0.79
15 0.73
16 0.65
17 0.58
18 0.51
19 0.47
20 0.4
21 0.37
22 0.33
23 0.29
24 0.3
25 0.27
26 0.25
27 0.21
28 0.2
29 0.19
30 0.17
31 0.18
32 0.15
33 0.15
34 0.13
35 0.13
36 0.12
37 0.09
38 0.09
39 0.09
40 0.09
41 0.09
42 0.17
43 0.17
44 0.19
45 0.2
46 0.19
47 0.27
48 0.36
49 0.45
50 0.48
51 0.58
52 0.62
53 0.7
54 0.77
55 0.77
56 0.76
57 0.73
58 0.67
59 0.62
60 0.62
61 0.62
62 0.57
63 0.53
64 0.49
65 0.46
66 0.48
67 0.49
68 0.46
69 0.43
70 0.51
71 0.56
72 0.61
73 0.62
74 0.61
75 0.62
76 0.61
77 0.55
78 0.45
79 0.35
80 0.26
81 0.19
82 0.14
83 0.09
84 0.12
85 0.2
86 0.31
87 0.41