Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9Y1H8

Protein Details
Accession A0A4P9Y1H8    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-36IFAPSEHRGKRKRLRQGEEAIPVHydrophilic
269-288VERMGKRRKHHPGSYPYEILBasic
NLS Segment(s)
PositionSequence
21-26RGKRKR
131-153KKGSLPKGKPKPKALPKEEFPKK
203-209QRGIKRR
Subcellular Location(s) mito 10, nucl 8, cyto 7
Family & Domain DBs
Amino Acid Sequences STPEGHSERAPRDIFAPSEHRGKRKRLRQGEEAIPVPTLASSTGAAKAPNTTLKMEGLEGRVRGIMEGMASLKGMSGDMLQVVKAVAVVVLKATEMTKEPPAMGVGSQNWGSGEFRGVQAPVSLPALPTSKKGSLPKGKPKPKALPKEEFPKKDKWTTVATKASMVQRVAWSTPQPPQDIKKRLSMMTQEKAWEILEGRGRHQRGIKRRNKAMDGYKLVYFTPNIHEPYSVMRFMMGREGVRMDEVAWLSYLGNKLEVAISKDYEKALVERMGKRRKHHPGSYPYEILPFLFNLSECISIVSDKSLMSSLDSDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.35
4 0.31
5 0.4
6 0.44
7 0.51
8 0.54
9 0.63
10 0.68
11 0.71
12 0.79
13 0.79
14 0.82
15 0.82
16 0.83
17 0.81
18 0.77
19 0.69
20 0.59
21 0.48
22 0.4
23 0.31
24 0.22
25 0.14
26 0.08
27 0.08
28 0.08
29 0.09
30 0.12
31 0.13
32 0.13
33 0.13
34 0.15
35 0.17
36 0.21
37 0.22
38 0.21
39 0.21
40 0.22
41 0.23
42 0.22
43 0.22
44 0.21
45 0.21
46 0.2
47 0.19
48 0.19
49 0.18
50 0.16
51 0.14
52 0.1
53 0.07
54 0.08
55 0.08
56 0.07
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.05
63 0.05
64 0.05
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.07
83 0.1
84 0.12
85 0.12
86 0.13
87 0.13
88 0.13
89 0.13
90 0.11
91 0.11
92 0.1
93 0.11
94 0.11
95 0.11
96 0.1
97 0.11
98 0.11
99 0.09
100 0.1
101 0.09
102 0.09
103 0.1
104 0.1
105 0.09
106 0.09
107 0.09
108 0.08
109 0.09
110 0.08
111 0.07
112 0.09
113 0.11
114 0.11
115 0.13
116 0.16
117 0.17
118 0.22
119 0.25
120 0.32
121 0.4
122 0.47
123 0.56
124 0.63
125 0.69
126 0.71
127 0.75
128 0.77
129 0.77
130 0.79
131 0.74
132 0.71
133 0.67
134 0.71
135 0.71
136 0.67
137 0.61
138 0.58
139 0.56
140 0.54
141 0.5
142 0.42
143 0.42
144 0.4
145 0.43
146 0.39
147 0.36
148 0.32
149 0.34
150 0.33
151 0.29
152 0.25
153 0.19
154 0.16
155 0.17
156 0.17
157 0.15
158 0.14
159 0.14
160 0.18
161 0.2
162 0.21
163 0.22
164 0.26
165 0.35
166 0.4
167 0.4
168 0.42
169 0.42
170 0.41
171 0.41
172 0.44
173 0.41
174 0.38
175 0.38
176 0.32
177 0.29
178 0.29
179 0.26
180 0.19
181 0.13
182 0.13
183 0.18
184 0.17
185 0.2
186 0.26
187 0.27
188 0.29
189 0.34
190 0.38
191 0.42
192 0.53
193 0.58
194 0.6
195 0.67
196 0.7
197 0.68
198 0.68
199 0.65
200 0.63
201 0.61
202 0.54
203 0.48
204 0.43
205 0.39
206 0.33
207 0.26
208 0.18
209 0.18
210 0.2
211 0.21
212 0.2
213 0.21
214 0.2
215 0.25
216 0.27
217 0.22
218 0.18
219 0.16
220 0.16
221 0.16
222 0.21
223 0.17
224 0.13
225 0.14
226 0.16
227 0.15
228 0.15
229 0.15
230 0.1
231 0.12
232 0.12
233 0.11
234 0.1
235 0.1
236 0.1
237 0.12
238 0.14
239 0.1
240 0.11
241 0.1
242 0.11
243 0.12
244 0.14
245 0.15
246 0.16
247 0.17
248 0.18
249 0.2
250 0.19
251 0.18
252 0.17
253 0.15
254 0.17
255 0.21
256 0.26
257 0.32
258 0.42
259 0.5
260 0.54
261 0.58
262 0.65
263 0.7
264 0.73
265 0.75
266 0.75
267 0.76
268 0.8
269 0.82
270 0.75
271 0.64
272 0.57
273 0.49
274 0.4
275 0.31
276 0.22
277 0.16
278 0.14
279 0.13
280 0.13
281 0.15
282 0.15
283 0.13
284 0.15
285 0.14
286 0.14
287 0.15
288 0.14
289 0.13
290 0.12
291 0.13
292 0.13
293 0.13
294 0.14