Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9XYX9

Protein Details
Accession A0A4P9XYX9    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
28-56RHFQSHHKDRHNRRSYRKLIHKRARILKYBasic
NLS Segment(s)
PositionSequence
37-52RHNRRSYRKLIHKRAR
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000589  Ribosomal_S15  
IPR005290  Ribosomal_S15_bac-type  
IPR009068  S15_NS1_RNA-bd  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00312  Ribosomal_S15  
CDD cd00353  Ribosomal_S15p_S13e  
Amino Acid Sequences MLGRSEADTGSPEVQAAIWTIRIRDLERHFQSHHKDRHNRRSYRKLIHKRARILKYLKSQDFAKYHQTLKALGLKPDDVENEIVVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.08
5 0.1
6 0.1
7 0.11
8 0.13
9 0.15
10 0.16
11 0.22
12 0.27
13 0.34
14 0.36
15 0.4
16 0.4
17 0.44
18 0.51
19 0.53
20 0.55
21 0.55
22 0.61
23 0.67
24 0.76
25 0.8
26 0.8
27 0.79
28 0.82
29 0.8
30 0.8
31 0.81
32 0.8
33 0.81
34 0.83
35 0.81
36 0.8
37 0.82
38 0.76
39 0.73
40 0.66
41 0.63
42 0.63
43 0.65
44 0.58
45 0.51
46 0.49
47 0.49
48 0.48
49 0.43
50 0.42
51 0.37
52 0.37
53 0.37
54 0.37
55 0.31
56 0.32
57 0.38
58 0.33
59 0.32
60 0.33
61 0.3
62 0.3
63 0.32
64 0.29
65 0.22
66 0.21