Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V1IYM5

Protein Details
Accession A0A4V1IYM5    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
39-73QPSNLKRKRKHGFLARKRSFGGRKILKRRAMKGRWBasic
NLS Segment(s)
PositionSequence
43-72LKRKRKHGFLARKRSFGGRKILKRRAMKGR
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MTSSLTSLRNPLGGEGGIPSLLSPVGVQVRGKKYGSEYQPSNLKRKRKHGFLARKRSFGGRKILKRRAMKGRWVLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.11
4 0.09
5 0.08
6 0.07
7 0.06
8 0.06
9 0.05
10 0.04
11 0.06
12 0.08
13 0.09
14 0.1
15 0.16
16 0.19
17 0.23
18 0.23
19 0.22
20 0.24
21 0.3
22 0.33
23 0.32
24 0.3
25 0.3
26 0.37
27 0.39
28 0.44
29 0.43
30 0.47
31 0.48
32 0.58
33 0.62
34 0.62
35 0.69
36 0.7
37 0.76
38 0.78
39 0.83
40 0.78
41 0.74
42 0.68
43 0.67
44 0.62
45 0.56
46 0.56
47 0.54
48 0.6
49 0.67
50 0.74
51 0.75
52 0.77
53 0.81
54 0.81
55 0.78
56 0.77
57 0.77