Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Y3D3

Protein Details
Accession A0A4P9Y3D3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-23WKGGSEKRRELDKKQKQRASSBasic
NLS Segment(s)
Subcellular Location(s) plas 13, extr 6, mito 4, E.R. 2, cyto_mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAWKGGSEKRRELDKKQKQRASSPSSPPLPADQLVVASLASICTAGGHSRYVWLSQSFTFNGSAGFIGYPNVNMPLFILGTAHGVPVVAFAILPSWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.77
3 0.81
4 0.82
5 0.76
6 0.79
7 0.79
8 0.77
9 0.74
10 0.7
11 0.68
12 0.64
13 0.6
14 0.53
15 0.46
16 0.39
17 0.31
18 0.24
19 0.16
20 0.14
21 0.13
22 0.12
23 0.09
24 0.06
25 0.05
26 0.04
27 0.04
28 0.03
29 0.03
30 0.03
31 0.03
32 0.04
33 0.05
34 0.06
35 0.06
36 0.07
37 0.08
38 0.08
39 0.1
40 0.1
41 0.11
42 0.11
43 0.14
44 0.13
45 0.14
46 0.13
47 0.12
48 0.11
49 0.1
50 0.09
51 0.07
52 0.07
53 0.05
54 0.06
55 0.06
56 0.06
57 0.06
58 0.08
59 0.08
60 0.08
61 0.08
62 0.09
63 0.09
64 0.08
65 0.08
66 0.06
67 0.09
68 0.09
69 0.08
70 0.07
71 0.07
72 0.06
73 0.07
74 0.07
75 0.05
76 0.04
77 0.04