Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Y0L0

Protein Details
Accession A0A4P9Y0L0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
112-136LQILKKGKIYKGKKKCPYCLERVKLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, extr 4, E.R. 4, vacu 4, plas 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001185  MS_channel  
IPR037673  MSC/AndL  
IPR036019  MscL_channel  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0008381  F:mechanosensitive monoatomic ion channel activity  
Pfam View protein in Pfam  
PF01741  MscL  
Amino Acid Sequences VYNNFKNFIKDGNTMDLAIGIILGGAFGKVVTSFSSDVLLPPIGILAVLQGVNLQHLFLVLEYPAGKPHQLYPTPEQAQEDGAVTWNYGRFLSVLVDFLLVAISLFLIIQILQILKKGKIYKGKKKCPYCLERVKLMASKCKSCGSELE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.25
4 0.19
5 0.15
6 0.11
7 0.05
8 0.03
9 0.03
10 0.03
11 0.02
12 0.02
13 0.02
14 0.02
15 0.03
16 0.03
17 0.04
18 0.05
19 0.08
20 0.09
21 0.09
22 0.11
23 0.11
24 0.11
25 0.12
26 0.12
27 0.08
28 0.08
29 0.07
30 0.06
31 0.05
32 0.05
33 0.03
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.05
41 0.05
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.03
48 0.04
49 0.05
50 0.05
51 0.07
52 0.07
53 0.08
54 0.08
55 0.12
56 0.17
57 0.19
58 0.22
59 0.25
60 0.33
61 0.34
62 0.34
63 0.31
64 0.25
65 0.24
66 0.2
67 0.17
68 0.09
69 0.08
70 0.08
71 0.07
72 0.07
73 0.07
74 0.07
75 0.06
76 0.07
77 0.06
78 0.06
79 0.08
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.07
86 0.06
87 0.04
88 0.04
89 0.03
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.03
97 0.04
98 0.04
99 0.05
100 0.08
101 0.1
102 0.11
103 0.17
104 0.2
105 0.26
106 0.36
107 0.45
108 0.54
109 0.62
110 0.73
111 0.78
112 0.83
113 0.86
114 0.87
115 0.85
116 0.84
117 0.84
118 0.79
119 0.75
120 0.7
121 0.66
122 0.6
123 0.56
124 0.55
125 0.5
126 0.5
127 0.46
128 0.49
129 0.46