Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9XZ20

Protein Details
Accession A0A4P9XZ20    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
45-65TCPGCGRSKRMHHLCRWCLRDHydrophilic
NLS Segment(s)
PositionSequence
22-38RTSHSKKRMRASNKGLK
Subcellular Location(s) mito 18.5, mito_nucl 13.333, nucl 7, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences LNRPSLASLLWDGLLRAVPKSRTSHSKKRMRASNKGLKDRKDLTTCPGCGRSKRMHHLCRWCLRDVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.11
3 0.11
4 0.14
5 0.15
6 0.19
7 0.23
8 0.27
9 0.35
10 0.43
11 0.52
12 0.58
13 0.66
14 0.69
15 0.74
16 0.79
17 0.76
18 0.77
19 0.76
20 0.75
21 0.73
22 0.76
23 0.72
24 0.66
25 0.65
26 0.6
27 0.56
28 0.52
29 0.45
30 0.42
31 0.44
32 0.43
33 0.4
34 0.43
35 0.41
36 0.39
37 0.44
38 0.47
39 0.48
40 0.58
41 0.64
42 0.66
43 0.71
44 0.78
45 0.82
46 0.82
47 0.78