Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1X750

Protein Details
Accession K1X750    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
53-75ISIFGRRRKRILRHAGQKSRVEKBasic
78-100SSTVTRRKQRGSKHRRSPCSSASHydrophilic
NLS Segment(s)
PositionSequence
58-93RRRKRILRHAGQKSRVEKAASSTVTRRKQRGSKHRR
Subcellular Location(s) nucl 14.5, cyto_nucl 12.5, cyto 7.5, cysk 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG mbe:MBM_00034  -  
CDD cd00067  GAL4  
Amino Acid Sequences MQNKQRMDESCLSILVKLGDFGEDDDLDLGRAHGPKGYFEGISKGFPGSDFAISIFGRRRKRILRHAGQKSRVEKAASSTVTRRKQRGSKHRRSPCSSASEFPSQSSSRRQYQASISMQHAARSTQLHRHPIDGHPGRCENLSDTARALGIAAMKRARNEIDSLIEANHVGEVTAGLPKISRKVHACTECQARKIKCDVGPGKAICTRWKSTIEGDSKCLQRAVSKILDVLDLPSLESFHRPTQLVQVVSPDPVIEQLQESRTTRTAVMAMTREHSLDPESKMNDALVSAPMGSVYEVANSGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.25
3 0.18
4 0.14
5 0.12
6 0.11
7 0.11
8 0.12
9 0.13
10 0.11
11 0.12
12 0.12
13 0.11
14 0.11
15 0.11
16 0.1
17 0.1
18 0.12
19 0.12
20 0.14
21 0.15
22 0.15
23 0.2
24 0.22
25 0.19
26 0.19
27 0.24
28 0.23
29 0.23
30 0.23
31 0.18
32 0.16
33 0.16
34 0.18
35 0.15
36 0.14
37 0.13
38 0.12
39 0.16
40 0.15
41 0.19
42 0.23
43 0.28
44 0.34
45 0.37
46 0.44
47 0.49
48 0.59
49 0.67
50 0.7
51 0.73
52 0.77
53 0.85
54 0.87
55 0.85
56 0.83
57 0.77
58 0.71
59 0.64
60 0.54
61 0.44
62 0.4
63 0.4
64 0.34
65 0.33
66 0.35
67 0.4
68 0.47
69 0.52
70 0.52
71 0.52
72 0.58
73 0.65
74 0.7
75 0.72
76 0.74
77 0.79
78 0.85
79 0.86
80 0.86
81 0.82
82 0.77
83 0.74
84 0.65
85 0.57
86 0.53
87 0.5
88 0.43
89 0.37
90 0.35
91 0.28
92 0.28
93 0.33
94 0.33
95 0.32
96 0.36
97 0.36
98 0.34
99 0.37
100 0.43
101 0.38
102 0.35
103 0.31
104 0.32
105 0.32
106 0.3
107 0.26
108 0.19
109 0.17
110 0.17
111 0.18
112 0.21
113 0.25
114 0.3
115 0.3
116 0.32
117 0.33
118 0.32
119 0.4
120 0.38
121 0.35
122 0.32
123 0.32
124 0.31
125 0.28
126 0.27
127 0.19
128 0.19
129 0.19
130 0.16
131 0.15
132 0.15
133 0.15
134 0.14
135 0.12
136 0.06
137 0.08
138 0.07
139 0.09
140 0.11
141 0.11
142 0.12
143 0.13
144 0.13
145 0.12
146 0.13
147 0.12
148 0.12
149 0.12
150 0.13
151 0.11
152 0.11
153 0.1
154 0.08
155 0.07
156 0.05
157 0.04
158 0.03
159 0.03
160 0.04
161 0.05
162 0.05
163 0.04
164 0.05
165 0.06
166 0.11
167 0.12
168 0.16
169 0.18
170 0.22
171 0.31
172 0.35
173 0.36
174 0.37
175 0.46
176 0.45
177 0.46
178 0.49
179 0.42
180 0.41
181 0.43
182 0.44
183 0.36
184 0.43
185 0.42
186 0.39
187 0.45
188 0.41
189 0.4
190 0.38
191 0.36
192 0.32
193 0.34
194 0.33
195 0.3
196 0.33
197 0.32
198 0.32
199 0.39
200 0.4
201 0.37
202 0.38
203 0.39
204 0.38
205 0.37
206 0.34
207 0.26
208 0.23
209 0.24
210 0.26
211 0.23
212 0.21
213 0.21
214 0.21
215 0.21
216 0.18
217 0.17
218 0.13
219 0.1
220 0.1
221 0.09
222 0.09
223 0.09
224 0.11
225 0.13
226 0.14
227 0.18
228 0.18
229 0.19
230 0.27
231 0.32
232 0.3
233 0.28
234 0.3
235 0.27
236 0.27
237 0.26
238 0.17
239 0.12
240 0.13
241 0.13
242 0.09
243 0.1
244 0.13
245 0.15
246 0.2
247 0.22
248 0.24
249 0.25
250 0.27
251 0.25
252 0.24
253 0.23
254 0.2
255 0.23
256 0.22
257 0.22
258 0.22
259 0.23
260 0.22
261 0.2
262 0.2
263 0.19
264 0.2
265 0.22
266 0.26
267 0.27
268 0.27
269 0.28
270 0.27
271 0.23
272 0.2
273 0.17
274 0.12
275 0.11
276 0.1
277 0.09
278 0.09
279 0.09
280 0.08
281 0.08
282 0.07
283 0.07