Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Y2E0

Protein Details
Accession A0A4P9Y2E0   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
42-62TSPARKVAGKRFFPKRKKFVSHydrophilic
NLS Segment(s)
PositionSequence
45-59ARKVAGKRFFPKRKK
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences SLGFFRKKFRSFRLKSDVKEALKYLESERRRIVVKTDHEGATSPARKVAGKRFFPKRKKFVSLSKDEPKTFISHVVLDKNKVVDAYRHFYHDLLNVITLPDGVSSKTIAQINKDVEALISRTEKLVNSFFTSIHSVAKDLVSKDEGKNKHIELKKTLEETQEYGSKIHVISKKWSTDTLEVLKAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.7
3 0.72
4 0.71
5 0.63
6 0.61
7 0.52
8 0.45
9 0.39
10 0.39
11 0.34
12 0.35
13 0.35
14 0.35
15 0.37
16 0.36
17 0.37
18 0.36
19 0.37
20 0.37
21 0.4
22 0.41
23 0.43
24 0.4
25 0.38
26 0.38
27 0.35
28 0.35
29 0.32
30 0.26
31 0.24
32 0.24
33 0.26
34 0.29
35 0.37
36 0.37
37 0.42
38 0.5
39 0.58
40 0.67
41 0.76
42 0.82
43 0.81
44 0.79
45 0.78
46 0.76
47 0.75
48 0.74
49 0.71
50 0.69
51 0.69
52 0.67
53 0.6
54 0.56
55 0.47
56 0.41
57 0.34
58 0.29
59 0.21
60 0.18
61 0.2
62 0.24
63 0.24
64 0.23
65 0.23
66 0.2
67 0.19
68 0.16
69 0.15
70 0.13
71 0.16
72 0.2
73 0.19
74 0.21
75 0.21
76 0.21
77 0.22
78 0.2
79 0.17
80 0.12
81 0.11
82 0.09
83 0.09
84 0.08
85 0.07
86 0.05
87 0.04
88 0.04
89 0.04
90 0.05
91 0.05
92 0.06
93 0.09
94 0.12
95 0.12
96 0.14
97 0.19
98 0.19
99 0.2
100 0.19
101 0.16
102 0.13
103 0.14
104 0.13
105 0.1
106 0.1
107 0.09
108 0.1
109 0.11
110 0.11
111 0.13
112 0.15
113 0.15
114 0.17
115 0.18
116 0.17
117 0.19
118 0.21
119 0.19
120 0.19
121 0.17
122 0.14
123 0.14
124 0.16
125 0.16
126 0.14
127 0.16
128 0.16
129 0.19
130 0.21
131 0.29
132 0.29
133 0.3
134 0.34
135 0.33
136 0.4
137 0.43
138 0.45
139 0.42
140 0.48
141 0.5
142 0.5
143 0.5
144 0.45
145 0.42
146 0.39
147 0.38
148 0.35
149 0.31
150 0.26
151 0.25
152 0.23
153 0.21
154 0.26
155 0.26
156 0.25
157 0.31
158 0.38
159 0.43
160 0.43
161 0.47
162 0.45
163 0.44
164 0.48
165 0.46
166 0.42