Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Y0X1

Protein Details
Accession A0A4P9Y0X1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
61-82DWGKGKQVREKDKKKGKNQGCSBasic
NLS Segment(s)
PositionSequence
66-77KQVREKDKKKGK
104-104R
142-157MKKRRKSESGSGKRDR
Subcellular Location(s) extr 13, mito 4, golg 4, plas 3, pero 1, E.R. 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MAFSEKKLVLALSSLTLITMLISAFLSWLTWSLTPFSAVINVALMDTSWELKASLTVWIGDWGKGKQVREKDKKKGKNQGCSDWGPHCRGLLGDEAVGGEGRRRKSGGREWEKEGCVIKSRDREEGGGWRGGQGNEEAEEGMKKRRKSESGSGKRDRTGGWDDRRGEGKAAAILLPAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.08
5 0.07
6 0.06
7 0.05
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.06
16 0.07
17 0.08
18 0.09
19 0.11
20 0.12
21 0.12
22 0.12
23 0.12
24 0.11
25 0.11
26 0.1
27 0.08
28 0.08
29 0.07
30 0.06
31 0.06
32 0.05
33 0.05
34 0.06
35 0.06
36 0.06
37 0.06
38 0.07
39 0.08
40 0.07
41 0.09
42 0.08
43 0.08
44 0.08
45 0.12
46 0.13
47 0.13
48 0.15
49 0.13
50 0.18
51 0.21
52 0.22
53 0.24
54 0.31
55 0.41
56 0.5
57 0.57
58 0.62
59 0.7
60 0.78
61 0.81
62 0.83
63 0.8
64 0.8
65 0.77
66 0.73
67 0.68
68 0.61
69 0.55
70 0.5
71 0.45
72 0.37
73 0.32
74 0.25
75 0.2
76 0.18
77 0.16
78 0.13
79 0.1
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.05
86 0.06
87 0.1
88 0.11
89 0.12
90 0.13
91 0.15
92 0.21
93 0.29
94 0.38
95 0.43
96 0.47
97 0.51
98 0.55
99 0.55
100 0.51
101 0.45
102 0.35
103 0.32
104 0.3
105 0.3
106 0.32
107 0.33
108 0.35
109 0.35
110 0.34
111 0.31
112 0.36
113 0.34
114 0.3
115 0.27
116 0.24
117 0.26
118 0.24
119 0.23
120 0.16
121 0.14
122 0.12
123 0.13
124 0.11
125 0.09
126 0.11
127 0.11
128 0.2
129 0.24
130 0.25
131 0.3
132 0.38
133 0.43
134 0.49
135 0.58
136 0.61
137 0.66
138 0.75
139 0.77
140 0.73
141 0.7
142 0.65
143 0.55
144 0.49
145 0.47
146 0.46
147 0.46
148 0.5
149 0.5
150 0.53
151 0.56
152 0.52
153 0.46
154 0.38
155 0.32
156 0.26
157 0.25
158 0.2