Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9Y1C0

Protein Details
Accession A0A4P9Y1C0    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
118-141PPTLKRPAPTRRGRGRPRKDGNDTBasic
NLS Segment(s)
PositionSequence
122-149KRPAPTRRGRGRPRKDGNDTARAAKARR
165-185TPRGRGRGRGRGRGRGRGGGR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR000637  HMGI/Y_DNA-bd_CS  
Gene Ontology GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00354  HMGI_Y  
Amino Acid Sequences MAEPVTGPSLEEQDAARVEAAFEELWAKTWTTLRPPPDRPRLSPALAIIGAKRERDLEKDELGLPDPSQVHAMNSKAEESMAPDTTTSPSTKSLSSLFLPPSSVSTTAGPLETPSSAPPTLKRPAPTRRGRGRPRKDGNDTARAAKARRLASLETSVINTTRNPTPRGRGRGRGRGRGRGRGGGRIFIAFGPSKVVIGIGDQLFPNPFRPVPYFFVPCHRSIDLLPGTPYLASVWTDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.12
5 0.12
6 0.11
7 0.13
8 0.09
9 0.08
10 0.09
11 0.09
12 0.11
13 0.12
14 0.12
15 0.13
16 0.17
17 0.2
18 0.25
19 0.31
20 0.37
21 0.44
22 0.52
23 0.6
24 0.67
25 0.7
26 0.67
27 0.68
28 0.67
29 0.61
30 0.55
31 0.46
32 0.4
33 0.34
34 0.3
35 0.23
36 0.24
37 0.23
38 0.21
39 0.2
40 0.19
41 0.2
42 0.24
43 0.29
44 0.26
45 0.26
46 0.28
47 0.28
48 0.26
49 0.26
50 0.23
51 0.17
52 0.17
53 0.15
54 0.14
55 0.15
56 0.14
57 0.14
58 0.16
59 0.17
60 0.15
61 0.15
62 0.15
63 0.13
64 0.13
65 0.11
66 0.12
67 0.14
68 0.13
69 0.12
70 0.12
71 0.13
72 0.14
73 0.16
74 0.13
75 0.11
76 0.13
77 0.14
78 0.14
79 0.15
80 0.15
81 0.16
82 0.17
83 0.19
84 0.17
85 0.16
86 0.17
87 0.15
88 0.16
89 0.14
90 0.14
91 0.12
92 0.11
93 0.12
94 0.11
95 0.11
96 0.09
97 0.08
98 0.08
99 0.07
100 0.07
101 0.07
102 0.09
103 0.09
104 0.1
105 0.11
106 0.15
107 0.19
108 0.21
109 0.24
110 0.28
111 0.36
112 0.45
113 0.52
114 0.56
115 0.62
116 0.7
117 0.77
118 0.81
119 0.81
120 0.82
121 0.83
122 0.81
123 0.79
124 0.78
125 0.73
126 0.7
127 0.63
128 0.55
129 0.5
130 0.43
131 0.37
132 0.32
133 0.32
134 0.25
135 0.26
136 0.26
137 0.24
138 0.25
139 0.27
140 0.25
141 0.19
142 0.19
143 0.18
144 0.15
145 0.15
146 0.12
147 0.13
148 0.17
149 0.2
150 0.22
151 0.25
152 0.33
153 0.41
154 0.5
155 0.52
156 0.57
157 0.62
158 0.69
159 0.73
160 0.75
161 0.72
162 0.73
163 0.73
164 0.72
165 0.68
166 0.66
167 0.6
168 0.59
169 0.55
170 0.47
171 0.43
172 0.34
173 0.31
174 0.23
175 0.24
176 0.16
177 0.14
178 0.15
179 0.14
180 0.13
181 0.12
182 0.12
183 0.09
184 0.09
185 0.14
186 0.1
187 0.12
188 0.11
189 0.13
190 0.14
191 0.15
192 0.16
193 0.15
194 0.16
195 0.19
196 0.23
197 0.27
198 0.31
199 0.37
200 0.39
201 0.37
202 0.46
203 0.45
204 0.43
205 0.44
206 0.39
207 0.35
208 0.31
209 0.38
210 0.32
211 0.31
212 0.31
213 0.26
214 0.26
215 0.23
216 0.23
217 0.15
218 0.13