Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Y0C3

Protein Details
Accession A0A4P9Y0C3   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
78-98REQEEKRRRYEERRRIREQGIBasic
NLS Segment(s)
Subcellular Location(s) nucl 9, cyto 7, plas 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR026686  UPF0708  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF14937  DUF4500  
Amino Acid Sequences MSQNTSGGGEKGGKVPSPPAPSTGNYGFFEGQRAATRIFKLTNPELFMKNNKYVMAFGVVTFTSLVAYFALDNAKYAREQEEKRRRYEERRRIREQGIPVNYGVDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.27
4 0.31
5 0.31
6 0.3
7 0.31
8 0.32
9 0.37
10 0.36
11 0.34
12 0.28
13 0.3
14 0.28
15 0.24
16 0.25
17 0.2
18 0.18
19 0.16
20 0.16
21 0.16
22 0.17
23 0.18
24 0.18
25 0.19
26 0.19
27 0.22
28 0.24
29 0.25
30 0.25
31 0.26
32 0.25
33 0.26
34 0.29
35 0.27
36 0.26
37 0.25
38 0.22
39 0.21
40 0.19
41 0.18
42 0.16
43 0.12
44 0.09
45 0.09
46 0.09
47 0.09
48 0.08
49 0.08
50 0.05
51 0.05
52 0.06
53 0.04
54 0.05
55 0.04
56 0.05
57 0.06
58 0.06
59 0.07
60 0.07
61 0.08
62 0.08
63 0.1
64 0.14
65 0.2
66 0.25
67 0.36
68 0.46
69 0.49
70 0.55
71 0.61
72 0.63
73 0.66
74 0.73
75 0.73
76 0.73
77 0.78
78 0.81
79 0.8
80 0.79
81 0.75
82 0.72
83 0.71
84 0.65
85 0.58
86 0.5