Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Y812

Protein Details
Accession A0A4P9Y812    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
54-76VTKGKSFRTEKNKKKRGSYRGGABasic
NLS Segment(s)
PositionSequence
61-70RTEKNKKKRG
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences GEMSKERKQNVPFCRVREDEVIFHDDRLKDNTWESKGGSDNYSYGFRANQDLIVTKGKSFRTEKNKKKRGSYRGGAIDFASHSIKFNLDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.59
3 0.56
4 0.53
5 0.48
6 0.4
7 0.38
8 0.39
9 0.32
10 0.3
11 0.31
12 0.25
13 0.24
14 0.25
15 0.24
16 0.2
17 0.23
18 0.28
19 0.26
20 0.26
21 0.25
22 0.23
23 0.24
24 0.24
25 0.21
26 0.16
27 0.15
28 0.15
29 0.16
30 0.13
31 0.11
32 0.1
33 0.1
34 0.11
35 0.11
36 0.1
37 0.09
38 0.1
39 0.12
40 0.16
41 0.15
42 0.14
43 0.19
44 0.19
45 0.24
46 0.27
47 0.33
48 0.4
49 0.51
50 0.61
51 0.67
52 0.76
53 0.76
54 0.83
55 0.84
56 0.83
57 0.82
58 0.78
59 0.76
60 0.76
61 0.71
62 0.62
63 0.52
64 0.44
65 0.35
66 0.31
67 0.24
68 0.15
69 0.15
70 0.15