Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9XYE2

Protein Details
Accession A0A4P9XYE2    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
26-59SKVFRFCRSKCHRNFKQKRNPRKVRWTKAFRYAAHydrophilic
93-115IQRVQDIKKKRERAFFKNRTIVIHydrophilic
NLS Segment(s)
PositionSequence
43-48KRNPRK
Subcellular Location(s) mito 13, nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR011017  TRASH_dom  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRLEKCYFCSSTCYPGHGITFVRNDSKVFRFCRSKCHRNFKQKRNPRKVRWTKAFRYAAGKEMTIDTTLEFEKRRNIPVRYDRDLMTTTVKAIQRVQDIKKKRERAFFKNRTIVIDMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.33
4 0.29
5 0.27
6 0.24
7 0.26
8 0.26
9 0.27
10 0.25
11 0.25
12 0.27
13 0.31
14 0.33
15 0.32
16 0.37
17 0.43
18 0.43
19 0.53
20 0.58
21 0.63
22 0.66
23 0.74
24 0.77
25 0.79
26 0.89
27 0.89
28 0.9
29 0.91
30 0.92
31 0.92
32 0.93
33 0.9
34 0.91
35 0.91
36 0.9
37 0.9
38 0.87
39 0.81
40 0.8
41 0.75
42 0.65
43 0.6
44 0.51
45 0.45
46 0.37
47 0.32
48 0.23
49 0.2
50 0.19
51 0.13
52 0.12
53 0.07
54 0.08
55 0.08
56 0.09
57 0.09
58 0.1
59 0.16
60 0.18
61 0.24
62 0.3
63 0.32
64 0.39
65 0.48
66 0.55
67 0.54
68 0.54
69 0.48
70 0.45
71 0.44
72 0.36
73 0.31
74 0.24
75 0.19
76 0.23
77 0.23
78 0.22
79 0.23
80 0.25
81 0.29
82 0.35
83 0.41
84 0.44
85 0.51
86 0.59
87 0.67
88 0.72
89 0.72
90 0.75
91 0.77
92 0.79
93 0.82
94 0.82
95 0.82
96 0.81
97 0.76
98 0.71