Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1IXR2

Protein Details
Accession A0A4V1IXR2    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKAASGTRTKRARKNPNAPKRPMSAHydrophilic
NLS Segment(s)
PositionSequence
9-22RTKRARKNPNAPKR
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKAASGTRTKRARKNPNAPKRPMSAYMFFANAQRDTVRAENPEATFGQIGKLLGERWRGMTSDDKKPYEEMNVKDKRRYETEKKAYEQLGSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.87
4 0.89
5 0.91
6 0.88
7 0.83
8 0.77
9 0.7
10 0.65
11 0.59
12 0.51
13 0.45
14 0.4
15 0.36
16 0.31
17 0.29
18 0.25
19 0.2
20 0.18
21 0.14
22 0.13
23 0.15
24 0.16
25 0.15
26 0.15
27 0.16
28 0.18
29 0.18
30 0.19
31 0.16
32 0.15
33 0.13
34 0.11
35 0.1
36 0.08
37 0.08
38 0.06
39 0.07
40 0.07
41 0.1
42 0.12
43 0.12
44 0.13
45 0.15
46 0.15
47 0.16
48 0.25
49 0.27
50 0.34
51 0.41
52 0.4
53 0.4
54 0.41
55 0.4
56 0.4
57 0.41
58 0.36
59 0.4
60 0.47
61 0.49
62 0.53
63 0.56
64 0.53
65 0.55
66 0.6
67 0.6
68 0.62
69 0.69
70 0.72
71 0.72
72 0.73
73 0.67