Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Y581

Protein Details
Accession A0A4P9Y581   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
354-373LAQWRDRRILRRSNTRRGYGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10, cyto_pero 7.333, cyto_nucl 6.833, cysk 6, mito 4, pero 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
IPR005135  Endo/exonuclease/phosphatase  
Gene Ontology GO:0004519  F:endonuclease activity  
GO:0004527  F:exonuclease activity  
Pfam View protein in Pfam  
PF03372  Exo_endo_phos  
Amino Acid Sequences MASSFDSSEPYPLPGEILTLDCRRTHGAAEVMDELARPLRVVQWNVERNYEADAVLEELRRLDADVYFLQEIDIGCTRSGGRDHFTELCEGLECLGGFVCEFEELDSPLRSAAHAGGGVHGNAILTRFPATFRGLQHLPEAFDWEKRGASLGEPRKGSRYACVASIDVPWMDKPILGYSVHLEVFCGIVGRVGEFSSLMQDAHEHAGTHPHQLIFGDLNTMAHSIARLSPRFAQDRYRFLSLGWVESAWWHTHVLGFHVEDGPVNTLLGRGWSEEVASRVRNDGFWDPWDPVEDITICPKAYRGMFSGKLDWTLLRGWEVRNKDMGNDAYALSDHRWLMVEVVPDRVSGDAGALAQWRDRRILRRSNTRRGYGLSLWGLAGQGLLVAGVEFHRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.13
4 0.15
5 0.18
6 0.2
7 0.22
8 0.21
9 0.24
10 0.26
11 0.26
12 0.25
13 0.25
14 0.27
15 0.26
16 0.29
17 0.28
18 0.25
19 0.23
20 0.21
21 0.17
22 0.14
23 0.13
24 0.1
25 0.09
26 0.16
27 0.22
28 0.24
29 0.3
30 0.38
31 0.45
32 0.47
33 0.49
34 0.43
35 0.38
36 0.4
37 0.34
38 0.24
39 0.17
40 0.15
41 0.15
42 0.16
43 0.16
44 0.12
45 0.11
46 0.11
47 0.11
48 0.11
49 0.1
50 0.09
51 0.12
52 0.13
53 0.16
54 0.16
55 0.15
56 0.14
57 0.15
58 0.14
59 0.14
60 0.16
61 0.13
62 0.13
63 0.14
64 0.15
65 0.15
66 0.18
67 0.17
68 0.18
69 0.18
70 0.23
71 0.25
72 0.25
73 0.25
74 0.22
75 0.2
76 0.17
77 0.16
78 0.12
79 0.11
80 0.09
81 0.08
82 0.07
83 0.07
84 0.06
85 0.06
86 0.06
87 0.04
88 0.05
89 0.06
90 0.07
91 0.08
92 0.11
93 0.11
94 0.11
95 0.11
96 0.11
97 0.1
98 0.1
99 0.09
100 0.08
101 0.09
102 0.09
103 0.1
104 0.1
105 0.1
106 0.09
107 0.08
108 0.07
109 0.06
110 0.07
111 0.05
112 0.05
113 0.07
114 0.07
115 0.08
116 0.1
117 0.13
118 0.16
119 0.17
120 0.23
121 0.23
122 0.23
123 0.26
124 0.25
125 0.23
126 0.19
127 0.24
128 0.18
129 0.19
130 0.19
131 0.17
132 0.16
133 0.14
134 0.15
135 0.11
136 0.12
137 0.19
138 0.24
139 0.28
140 0.3
141 0.31
142 0.33
143 0.34
144 0.33
145 0.27
146 0.26
147 0.22
148 0.22
149 0.23
150 0.2
151 0.19
152 0.19
153 0.17
154 0.11
155 0.1
156 0.09
157 0.08
158 0.08
159 0.07
160 0.07
161 0.07
162 0.09
163 0.09
164 0.09
165 0.09
166 0.12
167 0.12
168 0.11
169 0.1
170 0.08
171 0.08
172 0.08
173 0.06
174 0.04
175 0.04
176 0.04
177 0.05
178 0.05
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.05
185 0.05
186 0.05
187 0.05
188 0.06
189 0.08
190 0.08
191 0.07
192 0.07
193 0.13
194 0.14
195 0.15
196 0.16
197 0.14
198 0.14
199 0.14
200 0.15
201 0.1
202 0.09
203 0.08
204 0.07
205 0.07
206 0.07
207 0.07
208 0.06
209 0.05
210 0.05
211 0.05
212 0.08
213 0.12
214 0.12
215 0.14
216 0.18
217 0.22
218 0.25
219 0.26
220 0.32
221 0.33
222 0.39
223 0.41
224 0.39
225 0.35
226 0.32
227 0.38
228 0.29
229 0.26
230 0.2
231 0.16
232 0.14
233 0.14
234 0.16
235 0.09
236 0.1
237 0.09
238 0.08
239 0.11
240 0.11
241 0.12
242 0.12
243 0.12
244 0.12
245 0.12
246 0.12
247 0.1
248 0.11
249 0.11
250 0.09
251 0.08
252 0.07
253 0.07
254 0.07
255 0.08
256 0.07
257 0.06
258 0.07
259 0.07
260 0.08
261 0.09
262 0.11
263 0.13
264 0.14
265 0.13
266 0.15
267 0.16
268 0.16
269 0.18
270 0.2
271 0.19
272 0.21
273 0.22
274 0.21
275 0.21
276 0.23
277 0.19
278 0.16
279 0.16
280 0.14
281 0.13
282 0.16
283 0.17
284 0.15
285 0.14
286 0.15
287 0.17
288 0.17
289 0.19
290 0.18
291 0.23
292 0.27
293 0.3
294 0.33
295 0.3
296 0.3
297 0.28
298 0.25
299 0.2
300 0.18
301 0.16
302 0.15
303 0.16
304 0.18
305 0.24
306 0.28
307 0.29
308 0.33
309 0.32
310 0.3
311 0.34
312 0.33
313 0.28
314 0.25
315 0.22
316 0.18
317 0.18
318 0.18
319 0.13
320 0.15
321 0.13
322 0.12
323 0.13
324 0.13
325 0.15
326 0.16
327 0.2
328 0.17
329 0.22
330 0.21
331 0.2
332 0.2
333 0.18
334 0.16
335 0.11
336 0.1
337 0.07
338 0.07
339 0.08
340 0.1
341 0.1
342 0.13
343 0.16
344 0.18
345 0.22
346 0.27
347 0.35
348 0.41
349 0.51
350 0.57
351 0.65
352 0.73
353 0.79
354 0.82
355 0.79
356 0.74
357 0.68
358 0.66
359 0.57
360 0.55
361 0.46
362 0.38
363 0.33
364 0.3
365 0.25
366 0.18
367 0.15
368 0.07
369 0.05
370 0.04
371 0.04
372 0.03
373 0.03
374 0.04