Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Y855

Protein Details
Accession A0A4P9Y855   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKTPWRMSQTRKRNARKRLKEVDGVHydrophilic
NLS Segment(s)
PositionSequence
28-34KRNARKR
Subcellular Location(s) mito 24.5, mito_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGAFRPSLTSFSGLLWKTPWRMSQTRKRNARKRLKEVDGVIDTLMNSGIRCRALTPFREYPREADLSAKEKYSVFAKNMAASGGRKSLHKVPHYTKIHLTRRSPDGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.21
4 0.23
5 0.24
6 0.27
7 0.3
8 0.3
9 0.38
10 0.46
11 0.54
12 0.61
13 0.68
14 0.75
15 0.81
16 0.83
17 0.87
18 0.89
19 0.89
20 0.88
21 0.87
22 0.82
23 0.77
24 0.69
25 0.65
26 0.55
27 0.45
28 0.35
29 0.26
30 0.2
31 0.15
32 0.13
33 0.06
34 0.05
35 0.05
36 0.06
37 0.06
38 0.06
39 0.07
40 0.11
41 0.14
42 0.17
43 0.24
44 0.3
45 0.33
46 0.37
47 0.37
48 0.35
49 0.35
50 0.34
51 0.28
52 0.24
53 0.23
54 0.23
55 0.24
56 0.22
57 0.19
58 0.17
59 0.18
60 0.18
61 0.19
62 0.16
63 0.2
64 0.21
65 0.22
66 0.22
67 0.21
68 0.2
69 0.17
70 0.18
71 0.18
72 0.18
73 0.17
74 0.22
75 0.28
76 0.34
77 0.39
78 0.45
79 0.47
80 0.56
81 0.61
82 0.61
83 0.62
84 0.65
85 0.69
86 0.68
87 0.68
88 0.64