Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9Y4X9

Protein Details
Accession A0A4P9Y4X9    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-28PSHKSFKVKRILGKKQKQNRPIPQWFRLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito_nucl 13.333, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR020083  Ribosomal_L39_CS  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
PROSITE View protein in PROSITE  
PS00051  RIBOSOMAL_L39E  
Amino Acid Sequences PSHKSFKVKRILGKKQKQNRPIPQWFRLRTDNTIQYNAKRRHWRRTKLGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.87
4 0.88
5 0.87
6 0.86
7 0.85
8 0.85
9 0.82
10 0.79
11 0.79
12 0.72
13 0.66
14 0.62
15 0.55
16 0.49
17 0.48
18 0.48
19 0.42
20 0.46
21 0.43
22 0.44
23 0.51
24 0.53
25 0.55
26 0.58
27 0.62
28 0.67
29 0.75
30 0.79